Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L0P8P9

Protein Details
Accession L0P8P9    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
95-115WLAKTRLRARLWKKNTRLDFAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_nucl 9.333, cyto_pero 8.166, nucl 6, mito 6, pero 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002452  Alpha_tubulin  
IPR008280  Tub_FtsZ_C  
IPR000217  Tubulin  
IPR037103  Tubulin/FtsZ-like_C  
IPR018316  Tubulin/FtsZ_2-layer-sand-dom  
IPR023123  Tubulin_C  
Gene Ontology GO:0005874  C:microtubule  
GO:0005525  F:GTP binding  
GO:0016787  F:hydrolase activity  
GO:0005200  F:structural constituent of cytoskeleton  
GO:0007017  P:microtubule-based process  
Pfam View protein in Pfam  
PF03953  Tubulin_C  
Amino Acid Sequences MATCLLYRGDVVTKDVNAAVAAVRTKRTIQFVDWCPTGFKLGVCYQPPQHVPHGDLAKVDRAVCMLSNTTSIAEAWSRLDHKFDLMYSKRAFVHWLAKTRLRARLWKKNTRLDFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.17
4 0.14
5 0.13
6 0.1
7 0.09
8 0.11
9 0.11
10 0.13
11 0.14
12 0.16
13 0.19
14 0.23
15 0.23
16 0.24
17 0.31
18 0.35
19 0.39
20 0.37
21 0.35
22 0.31
23 0.3
24 0.28
25 0.2
26 0.15
27 0.14
28 0.16
29 0.2
30 0.21
31 0.23
32 0.22
33 0.26
34 0.28
35 0.27
36 0.28
37 0.24
38 0.24
39 0.26
40 0.27
41 0.22
42 0.21
43 0.19
44 0.17
45 0.17
46 0.15
47 0.1
48 0.09
49 0.09
50 0.08
51 0.08
52 0.07
53 0.07
54 0.07
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.07
61 0.07
62 0.08
63 0.09
64 0.11
65 0.11
66 0.13
67 0.13
68 0.14
69 0.14
70 0.14
71 0.2
72 0.21
73 0.27
74 0.26
75 0.29
76 0.29
77 0.28
78 0.3
79 0.25
80 0.32
81 0.31
82 0.38
83 0.4
84 0.45
85 0.53
86 0.55
87 0.6
88 0.55
89 0.6
90 0.62
91 0.68
92 0.72
93 0.75
94 0.78
95 0.8