Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L0PA74

Protein Details
Accession L0PA74    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
68-88ALVVRTKKETRRKDGKYIRFDHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 9, golg 5, cyto_nucl 4, nucl 3.5, cyto 3.5, extr 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036853  Ribosomal_L14_sf  
IPR000218  Ribosomal_L14P  
IPR000206  Ribosomal_L7/12  
IPR014719  Ribosomal_L7/12_C/ClpS-like  
IPR013823  Ribosomal_L7/L12_C  
IPR008932  Ribosomal_L7/L12_oligo  
IPR036235  Ribosomal_L7/L12_oligo_N_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00542  Ribosomal_L12  
PF16320  Ribosomal_L12_N  
PF00238  Ribosomal_L14  
Amino Acid Sequences AQLAECINVLKSGKYAKIGCFFVENIILCLIYSLGDEIVVVIQKARSSGLSAGSQNINKVQRGDIKHALVVRTKKETRRKDGKYIRFDDNACILINKKEPIGTRILGSDPRSAVTPTVSLLTVDQISCLTLKETAELVSQLKIHLNIQDIAPVVTSVPLSTSEPVHQENDEEKEEKRLFNVTLESYDPAAKAKVIKEIKSILGLNLVESKKFVESSPKMLKEGVNKEDADKIKKTFEDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.33
4 0.38
5 0.39
6 0.37
7 0.35
8 0.33
9 0.28
10 0.3
11 0.24
12 0.19
13 0.18
14 0.17
15 0.13
16 0.13
17 0.11
18 0.06
19 0.06
20 0.06
21 0.05
22 0.05
23 0.05
24 0.05
25 0.06
26 0.06
27 0.06
28 0.06
29 0.07
30 0.08
31 0.08
32 0.09
33 0.08
34 0.11
35 0.12
36 0.15
37 0.17
38 0.18
39 0.2
40 0.23
41 0.23
42 0.22
43 0.26
44 0.26
45 0.24
46 0.24
47 0.25
48 0.28
49 0.32
50 0.38
51 0.38
52 0.36
53 0.37
54 0.38
55 0.36
56 0.35
57 0.35
58 0.32
59 0.35
60 0.38
61 0.45
62 0.53
63 0.6
64 0.64
65 0.7
66 0.72
67 0.75
68 0.8
69 0.81
70 0.8
71 0.76
72 0.71
73 0.64
74 0.59
75 0.51
76 0.42
77 0.34
78 0.25
79 0.2
80 0.16
81 0.15
82 0.17
83 0.15
84 0.13
85 0.14
86 0.15
87 0.17
88 0.2
89 0.18
90 0.16
91 0.16
92 0.17
93 0.17
94 0.19
95 0.18
96 0.15
97 0.15
98 0.15
99 0.14
100 0.13
101 0.11
102 0.09
103 0.07
104 0.08
105 0.07
106 0.06
107 0.06
108 0.07
109 0.07
110 0.06
111 0.06
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.06
119 0.07
120 0.07
121 0.08
122 0.08
123 0.09
124 0.09
125 0.09
126 0.09
127 0.09
128 0.09
129 0.09
130 0.1
131 0.11
132 0.12
133 0.12
134 0.11
135 0.13
136 0.12
137 0.11
138 0.11
139 0.09
140 0.07
141 0.06
142 0.06
143 0.04
144 0.05
145 0.06
146 0.07
147 0.08
148 0.1
149 0.11
150 0.14
151 0.16
152 0.16
153 0.15
154 0.16
155 0.18
156 0.21
157 0.22
158 0.21
159 0.2
160 0.27
161 0.28
162 0.27
163 0.25
164 0.24
165 0.22
166 0.23
167 0.26
168 0.18
169 0.19
170 0.2
171 0.2
172 0.18
173 0.18
174 0.16
175 0.14
176 0.13
177 0.12
178 0.14
179 0.14
180 0.23
181 0.26
182 0.28
183 0.31
184 0.33
185 0.33
186 0.34
187 0.34
188 0.25
189 0.25
190 0.23
191 0.21
192 0.25
193 0.24
194 0.2
195 0.2
196 0.21
197 0.18
198 0.19
199 0.19
200 0.21
201 0.24
202 0.33
203 0.43
204 0.44
205 0.44
206 0.45
207 0.48
208 0.47
209 0.52
210 0.47
211 0.42
212 0.4
213 0.41
214 0.47
215 0.48
216 0.45
217 0.41
218 0.39
219 0.41