Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L0PB14

Protein Details
Accession L0PB14    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
153-172EKTYIFKNPRPPRPNALRIYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 8.5, cysk 3, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004193  Glyco_hydro_13_N  
IPR013783  Ig-like_fold  
IPR014756  Ig_E-set  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF02922  CBM_48  
CDD cd02854  E_set_GBE_euk_N  
Amino Acid Sequences MLDIISLDPLLLPYNEVLEKRYESVKNLIKLIESSEGLDSFTRSYLHMGLHVKPNKDLVYREWAPNAVSASLVGDFNEWDTQRHPMVKDVHSIFEVVVSAVNGKVAIPHESRVKICMVTTSGDTIYRIPAWIRRVTQDLSVSSIYDGIFWNPEKTYIFKNPRPPRPNALRIYEVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.14
4 0.15
5 0.17
6 0.19
7 0.2
8 0.27
9 0.26
10 0.27
11 0.35
12 0.41
13 0.41
14 0.4
15 0.39
16 0.33
17 0.32
18 0.31
19 0.25
20 0.19
21 0.17
22 0.16
23 0.16
24 0.16
25 0.15
26 0.13
27 0.1
28 0.11
29 0.1
30 0.09
31 0.11
32 0.12
33 0.12
34 0.16
35 0.18
36 0.2
37 0.28
38 0.32
39 0.31
40 0.3
41 0.33
42 0.31
43 0.3
44 0.29
45 0.23
46 0.28
47 0.29
48 0.3
49 0.28
50 0.26
51 0.24
52 0.24
53 0.21
54 0.12
55 0.1
56 0.09
57 0.08
58 0.08
59 0.07
60 0.06
61 0.05
62 0.05
63 0.06
64 0.08
65 0.08
66 0.08
67 0.09
68 0.12
69 0.13
70 0.15
71 0.15
72 0.18
73 0.22
74 0.22
75 0.27
76 0.25
77 0.25
78 0.23
79 0.23
80 0.17
81 0.13
82 0.12
83 0.06
84 0.05
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.03
91 0.05
92 0.06
93 0.1
94 0.1
95 0.13
96 0.17
97 0.19
98 0.2
99 0.2
100 0.2
101 0.17
102 0.16
103 0.16
104 0.13
105 0.13
106 0.13
107 0.13
108 0.13
109 0.13
110 0.13
111 0.12
112 0.12
113 0.11
114 0.11
115 0.11
116 0.15
117 0.19
118 0.23
119 0.24
120 0.25
121 0.29
122 0.3
123 0.33
124 0.32
125 0.29
126 0.28
127 0.26
128 0.24
129 0.2
130 0.19
131 0.15
132 0.12
133 0.12
134 0.09
135 0.12
136 0.13
137 0.15
138 0.14
139 0.17
140 0.18
141 0.2
142 0.26
143 0.33
144 0.41
145 0.45
146 0.56
147 0.64
148 0.73
149 0.76
150 0.76
151 0.76
152 0.77
153 0.8
154 0.76
155 0.73