Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L0PCJ9

Protein Details
Accession L0PCJ9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MSESYHFRSRARRKKKCKHGSTTSFWRRINHydrophilic
NLS Segment(s)
PositionSequence
10-16RARRKKK
Subcellular Location(s) nucl 14.5, mito_nucl 12.666, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MSESYHFRSRARRKKKCKHGSTTSFWRRINMFRHGPTFMIFTTKRSCFPAFRVTDSIDVTKLRRKKATQKHNMYYELNNNLYSSENDVIYESFFRKNVSSKSLVIINLVVANIFIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.94
3 0.95
4 0.94
5 0.93
6 0.92
7 0.9
8 0.87
9 0.88
10 0.86
11 0.83
12 0.73
13 0.66
14 0.58
15 0.56
16 0.53
17 0.5
18 0.47
19 0.43
20 0.45
21 0.43
22 0.4
23 0.35
24 0.31
25 0.23
26 0.22
27 0.19
28 0.19
29 0.23
30 0.24
31 0.24
32 0.27
33 0.29
34 0.25
35 0.28
36 0.34
37 0.31
38 0.32
39 0.33
40 0.3
41 0.3
42 0.29
43 0.26
44 0.18
45 0.17
46 0.15
47 0.18
48 0.21
49 0.23
50 0.27
51 0.31
52 0.41
53 0.5
54 0.6
55 0.65
56 0.7
57 0.74
58 0.73
59 0.73
60 0.65
61 0.58
62 0.53
63 0.47
64 0.38
65 0.32
66 0.26
67 0.23
68 0.22
69 0.19
70 0.18
71 0.14
72 0.13
73 0.13
74 0.14
75 0.13
76 0.13
77 0.14
78 0.12
79 0.13
80 0.14
81 0.15
82 0.16
83 0.22
84 0.25
85 0.29
86 0.31
87 0.3
88 0.33
89 0.35
90 0.33
91 0.29
92 0.25
93 0.2
94 0.17
95 0.15
96 0.12