Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L0PF85

Protein Details
Accession L0PF85    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MVLYFSTKRKTKTKKPKPKPRAPLDKTFNCHydrophilic
NLS Segment(s)
PositionSequence
8-22KRKTKTKKPKPKPRA
Subcellular Location(s) nucl 11.5, mito_nucl 11, mito 9.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Amino Acid Sequences MVLYFSTKRKTKTKKPKPKPRAPLDKTFNCLFCNHEKNLSAPVDIYSDWIDACDAVANHTNKNLKKDLASNDNDYNSENL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.89
3 0.94
4 0.95
5 0.96
6 0.95
7 0.94
8 0.94
9 0.89
10 0.88
11 0.85
12 0.79
13 0.73
14 0.65
15 0.55
16 0.45
17 0.4
18 0.33
19 0.31
20 0.31
21 0.27
22 0.28
23 0.27
24 0.27
25 0.31
26 0.28
27 0.2
28 0.16
29 0.15
30 0.13
31 0.12
32 0.13
33 0.09
34 0.08
35 0.08
36 0.08
37 0.07
38 0.06
39 0.06
40 0.06
41 0.05
42 0.08
43 0.14
44 0.15
45 0.16
46 0.21
47 0.28
48 0.29
49 0.34
50 0.36
51 0.32
52 0.34
53 0.4
54 0.43
55 0.45
56 0.47
57 0.48
58 0.49
59 0.49
60 0.46