Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L0PE38

Protein Details
Accession L0PE38    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGTRRPKKGQFLAKKRRCGLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 12.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019367  PDZ-binding_CRIPT  
Gene Ontology GO:0005737  C:cytoplasm  
Pfam View protein in Pfam  
PF10235  Cript  
Amino Acid Sequences MGTRRPKKGQFLAKKRRCGLVMNRYDPYGTGCSVCKQRTHHLGAKYCPSCAYKQGKCSICGKKILDTSAYKQSSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.8
3 0.76
4 0.67
5 0.63
6 0.62
7 0.61
8 0.62
9 0.57
10 0.55
11 0.5
12 0.48
13 0.41
14 0.34
15 0.25
16 0.16
17 0.13
18 0.13
19 0.15
20 0.21
21 0.22
22 0.23
23 0.24
24 0.29
25 0.35
26 0.4
27 0.43
28 0.44
29 0.47
30 0.46
31 0.52
32 0.47
33 0.4
34 0.37
35 0.34
36 0.29
37 0.32
38 0.39
39 0.34
40 0.39
41 0.48
42 0.48
43 0.49
44 0.56
45 0.56
46 0.52
47 0.55
48 0.51
49 0.49
50 0.5
51 0.5
52 0.47
53 0.43
54 0.44
55 0.46