Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L0P9H1

Protein Details
Accession L0P9H1    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
32-60KTTEVSQKKKPPSSKKKQRHDKSIAEPRYHydrophilic
NLS Segment(s)
PositionSequence
39-51KKKPPSSKKKQRH
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028651  ING_fam  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0032991  C:protein-containing complex  
GO:0046872  F:metal ion binding  
CDD cd15505  PHD_ING  
Amino Acid Sequences IQVEQHLHTVNQTLQKLKEAWLESQNVKKVEKTTEVSQKKKPPSSKKKQRHDKSIAEPRYCFCNQISYGRMIACDNHNCTKEWFHWDCVSITSAPKGKWTCSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.32
4 0.31
5 0.34
6 0.29
7 0.31
8 0.31
9 0.34
10 0.34
11 0.39
12 0.42
13 0.38
14 0.36
15 0.35
16 0.33
17 0.33
18 0.34
19 0.33
20 0.34
21 0.42
22 0.49
23 0.51
24 0.56
25 0.6
26 0.62
27 0.65
28 0.67
29 0.68
30 0.71
31 0.78
32 0.82
33 0.84
34 0.87
35 0.91
36 0.9
37 0.89
38 0.86
39 0.82
40 0.8
41 0.8
42 0.76
43 0.67
44 0.6
45 0.51
46 0.49
47 0.42
48 0.34
49 0.24
50 0.23
51 0.23
52 0.27
53 0.28
54 0.23
55 0.24
56 0.23
57 0.23
58 0.17
59 0.18
60 0.19
61 0.22
62 0.24
63 0.29
64 0.3
65 0.31
66 0.33
67 0.35
68 0.33
69 0.37
70 0.35
71 0.34
72 0.36
73 0.36
74 0.35
75 0.32
76 0.31
77 0.24
78 0.23
79 0.24
80 0.26
81 0.25
82 0.32
83 0.32