Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L0P860

Protein Details
Accession L0P860   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
97-117DAIQKVRKTSFKKKDNQSVIAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.833, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR014812  Vps51  
Gene Ontology GO:0005829  C:cytosol  
GO:0000938  C:GARP complex  
GO:0007030  P:Golgi organization  
GO:0006869  P:lipid transport  
GO:0015031  P:protein transport  
GO:0042147  P:retrograde transport, endosome to Golgi  
Pfam View protein in Pfam  
PF08700  Vps51  
Amino Acid Sequences MNCCQDISEKHNKDIQIKRTLREFYKLDTPTTQFVTQVPKLDTDNFDIEQYAKDVLCNNPQTLLNLENTLIQEIHNLECEKKILVYDNYTKLLSVGDAIQKVRKTSFKKKDNQSVIAILEPTLAHIGTLSTLLSESLVRKETKDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.57
4 0.56
5 0.56
6 0.59
7 0.62
8 0.55
9 0.54
10 0.48
11 0.41
12 0.47
13 0.46
14 0.41
15 0.39
16 0.39
17 0.35
18 0.37
19 0.33
20 0.24
21 0.25
22 0.29
23 0.27
24 0.29
25 0.27
26 0.24
27 0.26
28 0.28
29 0.27
30 0.24
31 0.25
32 0.21
33 0.2
34 0.19
35 0.17
36 0.15
37 0.14
38 0.11
39 0.08
40 0.08
41 0.1
42 0.12
43 0.17
44 0.19
45 0.18
46 0.19
47 0.19
48 0.2
49 0.19
50 0.19
51 0.13
52 0.12
53 0.12
54 0.11
55 0.11
56 0.1
57 0.09
58 0.07
59 0.07
60 0.08
61 0.08
62 0.09
63 0.1
64 0.09
65 0.1
66 0.11
67 0.1
68 0.09
69 0.09
70 0.1
71 0.11
72 0.15
73 0.2
74 0.22
75 0.24
76 0.24
77 0.23
78 0.19
79 0.18
80 0.13
81 0.1
82 0.08
83 0.09
84 0.11
85 0.12
86 0.16
87 0.17
88 0.18
89 0.21
90 0.27
91 0.32
92 0.42
93 0.51
94 0.57
95 0.65
96 0.74
97 0.81
98 0.81
99 0.77
100 0.69
101 0.62
102 0.54
103 0.46
104 0.37
105 0.26
106 0.2
107 0.15
108 0.13
109 0.1
110 0.09
111 0.07
112 0.07
113 0.07
114 0.06
115 0.07
116 0.06
117 0.05
118 0.05
119 0.06
120 0.06
121 0.08
122 0.09
123 0.13
124 0.17
125 0.18