Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L0PI29

Protein Details
Accession L0PI29    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSKSFKRKYKKLCERFDALIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR032742  Iec3  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF14612  Ino80_Iec3  
Amino Acid Sequences MSKSFKRKYKKLCERFDALIEESEQLQEQIQKAKAISNRISAENTYLLDLILYQKNNSISPSLSADSESGAEFDENNFKNQNDASSDISSYYRDKTPPHLLSLSPHWDYSPPPSPGKENEDDEYENQSILLTNSLLLYEKNKEASETMLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.76
3 0.69
4 0.62
5 0.52
6 0.44
7 0.35
8 0.29
9 0.23
10 0.2
11 0.16
12 0.12
13 0.11
14 0.12
15 0.13
16 0.18
17 0.19
18 0.2
19 0.2
20 0.25
21 0.27
22 0.32
23 0.33
24 0.33
25 0.34
26 0.34
27 0.36
28 0.31
29 0.3
30 0.25
31 0.22
32 0.16
33 0.13
34 0.11
35 0.09
36 0.09
37 0.1
38 0.12
39 0.12
40 0.11
41 0.13
42 0.15
43 0.16
44 0.16
45 0.14
46 0.11
47 0.13
48 0.15
49 0.13
50 0.12
51 0.12
52 0.12
53 0.11
54 0.11
55 0.09
56 0.06
57 0.06
58 0.06
59 0.05
60 0.06
61 0.11
62 0.11
63 0.13
64 0.14
65 0.13
66 0.15
67 0.15
68 0.15
69 0.11
70 0.13
71 0.15
72 0.15
73 0.15
74 0.15
75 0.15
76 0.15
77 0.15
78 0.15
79 0.14
80 0.15
81 0.16
82 0.22
83 0.31
84 0.31
85 0.33
86 0.32
87 0.31
88 0.32
89 0.36
90 0.35
91 0.27
92 0.25
93 0.22
94 0.22
95 0.23
96 0.26
97 0.29
98 0.27
99 0.28
100 0.3
101 0.33
102 0.37
103 0.43
104 0.41
105 0.37
106 0.36
107 0.38
108 0.38
109 0.36
110 0.37
111 0.3
112 0.25
113 0.2
114 0.18
115 0.15
116 0.13
117 0.13
118 0.07
119 0.07
120 0.07
121 0.08
122 0.09
123 0.09
124 0.12
125 0.15
126 0.18
127 0.21
128 0.21
129 0.23
130 0.23