Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L0PDA3

Protein Details
Accession L0PDA3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
10-33THVREGRDVRKDNKKNKKEAEEEDBasic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, mito 9, cyto_nucl 8, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MAPNALYHVTHVREGRDVRKDNKKNKKEAEEEDVLSMPFSAVFICSNSSITVFFDCFSNITFIIASAMVGITACYWRDSCFLDFSDRRLFQPRFLSTQSTNALGFSRFLKLREILKRKEWHQSLLGVTIRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.4
3 0.43
4 0.48
5 0.51
6 0.6
7 0.68
8 0.72
9 0.79
10 0.8
11 0.81
12 0.83
13 0.84
14 0.81
15 0.77
16 0.74
17 0.67
18 0.6
19 0.52
20 0.43
21 0.34
22 0.26
23 0.2
24 0.12
25 0.07
26 0.06
27 0.04
28 0.04
29 0.05
30 0.05
31 0.07
32 0.07
33 0.08
34 0.08
35 0.09
36 0.09
37 0.09
38 0.09
39 0.08
40 0.08
41 0.08
42 0.08
43 0.07
44 0.08
45 0.08
46 0.07
47 0.07
48 0.07
49 0.06
50 0.06
51 0.06
52 0.05
53 0.04
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.04
61 0.05
62 0.05
63 0.06
64 0.08
65 0.11
66 0.12
67 0.14
68 0.14
69 0.21
70 0.21
71 0.24
72 0.31
73 0.29
74 0.3
75 0.36
76 0.36
77 0.34
78 0.41
79 0.4
80 0.37
81 0.38
82 0.41
83 0.34
84 0.39
85 0.36
86 0.3
87 0.28
88 0.23
89 0.22
90 0.18
91 0.18
92 0.13
93 0.17
94 0.16
95 0.17
96 0.21
97 0.23
98 0.31
99 0.41
100 0.47
101 0.48
102 0.55
103 0.62
104 0.62
105 0.69
106 0.64
107 0.59
108 0.54
109 0.53
110 0.47
111 0.45