Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L0PAJ1

Protein Details
Accession L0PAJ1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-26GKTLKDFKTLYKRRTNKICGMDFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR041095  EFG_II  
IPR035647  EFG_III/V  
IPR000640  EFG_V-like  
IPR020568  Ribosomal_S5_D2-typ_fold  
IPR014721  Ribosomal_S5_D2-typ_fold_subgr  
IPR009000  Transl_B-barrel_sf  
IPR005517  Transl_elong_EFG/EF2_IV  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF00679  EFG_C  
PF14492  EFG_III  
PF03764  EFG_IV  
CDD cd01681  aeEF2_snRNP_like_IV  
cd04096  eEF2_snRNP_like_C  
cd16268  EF2_II  
cd16261  EF2_snRNP_III  
Amino Acid Sequences MMQGKTLKDFKTLYKRRTNKICGMDFHSIRKLIKNVQRTVLMMGRYVEAIEDCPAGNIVGLVGVDQFLLKSGTLTTSEIAYNMKVMKFSVSPVVKVAVDVKNANDLPKLVEGLKRLSKSDPCVLCYTSESGEHIVAGAGELHLEICLKDLEEDHACIPLKKSPPVVSYRETVTSTSTMTALSKSPNKHNRIFMTAEPMDEELSLAIESGKISSRDDFKVRARMIADEFGWDIADARKIWCFGPDTVGPNVIVDQTKAIAYLNAFQWASKEGPIAEENMRSCRFNILDVTLHADAIHRGGGQIIPTARRVVYASTLLANPCLQEPIFLTEIQCPEQAMGGIYGVLNRRRGHVFSEEQRPGTPLFNIKAYLPVLESFGFTAELRQATGGQAFPQTVFDHWDTMSGSPFDVTSKVGTVVTEIRKRKGLKET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.73
3 0.77
4 0.85
5 0.84
6 0.81
7 0.82
8 0.79
9 0.73
10 0.72
11 0.72
12 0.64
13 0.61
14 0.58
15 0.52
16 0.48
17 0.49
18 0.47
19 0.47
20 0.52
21 0.55
22 0.55
23 0.56
24 0.57
25 0.52
26 0.52
27 0.47
28 0.4
29 0.32
30 0.28
31 0.24
32 0.21
33 0.19
34 0.15
35 0.11
36 0.11
37 0.11
38 0.1
39 0.09
40 0.1
41 0.1
42 0.09
43 0.09
44 0.07
45 0.05
46 0.05
47 0.05
48 0.05
49 0.04
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.06
56 0.06
57 0.06
58 0.07
59 0.09
60 0.1
61 0.12
62 0.11
63 0.12
64 0.12
65 0.13
66 0.13
67 0.11
68 0.12
69 0.14
70 0.14
71 0.13
72 0.13
73 0.15
74 0.15
75 0.16
76 0.23
77 0.21
78 0.21
79 0.22
80 0.24
81 0.21
82 0.21
83 0.25
84 0.19
85 0.21
86 0.21
87 0.21
88 0.25
89 0.26
90 0.26
91 0.22
92 0.19
93 0.18
94 0.19
95 0.2
96 0.14
97 0.17
98 0.18
99 0.23
100 0.28
101 0.27
102 0.27
103 0.3
104 0.33
105 0.35
106 0.42
107 0.38
108 0.36
109 0.38
110 0.37
111 0.33
112 0.31
113 0.28
114 0.2
115 0.19
116 0.17
117 0.15
118 0.14
119 0.13
120 0.11
121 0.08
122 0.07
123 0.06
124 0.05
125 0.04
126 0.03
127 0.04
128 0.03
129 0.03
130 0.04
131 0.04
132 0.04
133 0.05
134 0.05
135 0.06
136 0.06
137 0.09
138 0.1
139 0.12
140 0.11
141 0.15
142 0.15
143 0.16
144 0.16
145 0.19
146 0.21
147 0.22
148 0.25
149 0.25
150 0.29
151 0.34
152 0.37
153 0.34
154 0.33
155 0.32
156 0.31
157 0.28
158 0.24
159 0.21
160 0.18
161 0.16
162 0.14
163 0.12
164 0.1
165 0.09
166 0.1
167 0.09
168 0.12
169 0.16
170 0.19
171 0.28
172 0.36
173 0.41
174 0.45
175 0.5
176 0.49
177 0.48
178 0.48
179 0.39
180 0.38
181 0.33
182 0.28
183 0.23
184 0.21
185 0.17
186 0.14
187 0.13
188 0.05
189 0.05
190 0.05
191 0.04
192 0.03
193 0.03
194 0.03
195 0.04
196 0.06
197 0.06
198 0.07
199 0.09
200 0.12
201 0.15
202 0.17
203 0.2
204 0.22
205 0.29
206 0.28
207 0.29
208 0.26
209 0.26
210 0.26
211 0.24
212 0.21
213 0.13
214 0.13
215 0.11
216 0.1
217 0.08
218 0.07
219 0.06
220 0.08
221 0.07
222 0.08
223 0.09
224 0.1
225 0.1
226 0.11
227 0.13
228 0.12
229 0.16
230 0.17
231 0.2
232 0.19
233 0.2
234 0.18
235 0.15
236 0.15
237 0.12
238 0.1
239 0.07
240 0.07
241 0.07
242 0.07
243 0.07
244 0.06
245 0.06
246 0.06
247 0.09
248 0.09
249 0.11
250 0.11
251 0.11
252 0.12
253 0.13
254 0.14
255 0.11
256 0.12
257 0.09
258 0.11
259 0.12
260 0.14
261 0.14
262 0.16
263 0.16
264 0.2
265 0.22
266 0.2
267 0.2
268 0.21
269 0.2
270 0.19
271 0.2
272 0.18
273 0.18
274 0.18
275 0.22
276 0.18
277 0.17
278 0.16
279 0.14
280 0.12
281 0.11
282 0.11
283 0.06
284 0.06
285 0.07
286 0.07
287 0.07
288 0.1
289 0.11
290 0.12
291 0.13
292 0.15
293 0.14
294 0.14
295 0.15
296 0.13
297 0.15
298 0.15
299 0.15
300 0.15
301 0.16
302 0.15
303 0.16
304 0.14
305 0.12
306 0.11
307 0.12
308 0.1
309 0.09
310 0.11
311 0.14
312 0.15
313 0.15
314 0.16
315 0.18
316 0.2
317 0.21
318 0.2
319 0.16
320 0.15
321 0.15
322 0.14
323 0.11
324 0.09
325 0.07
326 0.07
327 0.07
328 0.09
329 0.13
330 0.16
331 0.2
332 0.2
333 0.24
334 0.27
335 0.29
336 0.31
337 0.33
338 0.38
339 0.4
340 0.5
341 0.5
342 0.48
343 0.47
344 0.44
345 0.39
346 0.33
347 0.29
348 0.25
349 0.23
350 0.24
351 0.25
352 0.23
353 0.26
354 0.25
355 0.22
356 0.18
357 0.17
358 0.17
359 0.16
360 0.16
361 0.12
362 0.12
363 0.13
364 0.11
365 0.12
366 0.13
367 0.13
368 0.13
369 0.14
370 0.13
371 0.14
372 0.16
373 0.15
374 0.13
375 0.15
376 0.15
377 0.15
378 0.17
379 0.16
380 0.15
381 0.19
382 0.19
383 0.19
384 0.18
385 0.21
386 0.2
387 0.19
388 0.22
389 0.17
390 0.17
391 0.15
392 0.15
393 0.14
394 0.13
395 0.14
396 0.12
397 0.13
398 0.14
399 0.14
400 0.14
401 0.16
402 0.22
403 0.3
404 0.37
405 0.4
406 0.43
407 0.5
408 0.53