Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L0PCT3

Protein Details
Accession L0PCT3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
80-100INMFRCWKKKLEKCNLHNIATHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 4.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MKACTKIILRISLQFKIKIKIDIVDLFIEIATHIGSKSVILDLFDILRQLDFESLTSLTYIKDKCKRQDIILAGNLKMNINMFRCWKKKLEKCNLHNIATEIYIYGIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.44
4 0.44
5 0.4
6 0.36
7 0.32
8 0.33
9 0.29
10 0.28
11 0.23
12 0.2
13 0.16
14 0.15
15 0.13
16 0.08
17 0.07
18 0.05
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.05
25 0.06
26 0.06
27 0.06
28 0.07
29 0.07
30 0.07
31 0.07
32 0.07
33 0.06
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.1
47 0.11
48 0.16
49 0.23
50 0.29
51 0.34
52 0.42
53 0.44
54 0.43
55 0.49
56 0.46
57 0.44
58 0.44
59 0.41
60 0.33
61 0.33
62 0.31
63 0.24
64 0.2
65 0.16
66 0.14
67 0.14
68 0.17
69 0.22
70 0.3
71 0.33
72 0.37
73 0.44
74 0.5
75 0.57
76 0.65
77 0.7
78 0.72
79 0.75
80 0.82
81 0.81
82 0.73
83 0.67
84 0.58
85 0.49
86 0.39
87 0.33
88 0.22