Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L0P8D1

Protein Details
Accession L0P8D1    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKNYSFKKSLKNRKQRDTYFKQLTMKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000235  Ribosomal_S5/S7  
IPR023798  Ribosomal_S7_dom  
IPR036823  Ribosomal_S7_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00177  Ribosomal_S7  
CDD cd14868  uS7_Mitochondria_Fungi  
Amino Acid Sequences MKNYSFKKSLKNRKQRDTYFKQLTMKFMSFNLLKRIEHSNTINTLFNHTVGIIMKKGKKTKAQKQLENAFLYIKQKTNTNPHFIFSKAIEKTSPLIKLISTKKGSKSIKIPVPLNEYQQHRKAIIWILEASNKRHNRNFSERLAQELIAVVDGTSSVFQRKEQLHKLALVRNFSNLTIINFKLDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.91
4 0.88
5 0.88
6 0.86
7 0.82
8 0.79
9 0.71
10 0.66
11 0.61
12 0.53
13 0.44
14 0.36
15 0.35
16 0.3
17 0.31
18 0.33
19 0.3
20 0.29
21 0.3
22 0.37
23 0.33
24 0.36
25 0.36
26 0.33
27 0.33
28 0.36
29 0.36
30 0.3
31 0.32
32 0.27
33 0.25
34 0.2
35 0.17
36 0.16
37 0.14
38 0.15
39 0.12
40 0.17
41 0.2
42 0.26
43 0.31
44 0.35
45 0.43
46 0.51
47 0.59
48 0.65
49 0.7
50 0.71
51 0.74
52 0.77
53 0.73
54 0.64
55 0.55
56 0.45
57 0.37
58 0.34
59 0.27
60 0.21
61 0.17
62 0.18
63 0.22
64 0.31
65 0.32
66 0.37
67 0.36
68 0.35
69 0.35
70 0.33
71 0.31
72 0.22
73 0.26
74 0.19
75 0.19
76 0.18
77 0.17
78 0.18
79 0.19
80 0.18
81 0.12
82 0.12
83 0.11
84 0.18
85 0.21
86 0.26
87 0.27
88 0.29
89 0.31
90 0.39
91 0.41
92 0.38
93 0.4
94 0.41
95 0.43
96 0.45
97 0.44
98 0.39
99 0.45
100 0.42
101 0.41
102 0.38
103 0.39
104 0.39
105 0.42
106 0.4
107 0.33
108 0.32
109 0.31
110 0.31
111 0.27
112 0.24
113 0.21
114 0.2
115 0.25
116 0.27
117 0.28
118 0.32
119 0.35
120 0.37
121 0.42
122 0.46
123 0.49
124 0.56
125 0.59
126 0.55
127 0.59
128 0.55
129 0.55
130 0.51
131 0.43
132 0.34
133 0.28
134 0.23
135 0.14
136 0.13
137 0.07
138 0.05
139 0.05
140 0.05
141 0.05
142 0.06
143 0.08
144 0.09
145 0.1
146 0.17
147 0.23
148 0.31
149 0.38
150 0.44
151 0.44
152 0.49
153 0.54
154 0.54
155 0.52
156 0.49
157 0.43
158 0.4
159 0.39
160 0.33
161 0.31
162 0.26
163 0.26
164 0.25
165 0.25