Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L0PC18

Protein Details
Accession L0PC18    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
141-160EARRIKAKATRERRVQRLLDHydrophilic
NLS Segment(s)
PositionSequence
64-83RQLHAAKRKGRHTGLGKRKG
146-151KAKATR
Subcellular Location(s) mito 13, nucl 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR035970  60S_ribosomal_L19/L19e_sf  
IPR000196  Ribosomal_L19/L19e  
IPR023638  Ribosomal_L19/L19e_CS  
IPR015972  Ribosomal_L19/L19e_dom1  
IPR039547  RPL19  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01280  Ribosomal_L19e  
PROSITE View protein in PROSITE  
PS00526  RIBOSOMAL_L19E  
Amino Acid Sequences MANLKYQKRLAAAVLKCGKRKIWLDPNEISEISNANSRQNIRRLIKDGLIIRKPSTMHSRYRVRQLHAAKRKGRHTGLGKRKGTAEARLSTKVQWQFRLRVLRRLLCRYRDDGKIDKYMYHRLYAKAKEAARSNMIQQQLEARRIKAKATRERRVQRLLDKRNEMLKTLDEKPNEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.48
3 0.49
4 0.5
5 0.47
6 0.46
7 0.48
8 0.49
9 0.5
10 0.54
11 0.57
12 0.58
13 0.61
14 0.57
15 0.53
16 0.43
17 0.33
18 0.26
19 0.21
20 0.22
21 0.18
22 0.16
23 0.2
24 0.23
25 0.28
26 0.33
27 0.41
28 0.4
29 0.45
30 0.47
31 0.47
32 0.45
33 0.45
34 0.44
35 0.43
36 0.44
37 0.4
38 0.36
39 0.36
40 0.34
41 0.33
42 0.36
43 0.32
44 0.34
45 0.4
46 0.48
47 0.49
48 0.59
49 0.59
50 0.54
51 0.58
52 0.6
53 0.63
54 0.63
55 0.68
56 0.64
57 0.65
58 0.67
59 0.65
60 0.59
61 0.56
62 0.55
63 0.57
64 0.62
65 0.65
66 0.61
67 0.55
68 0.55
69 0.51
70 0.44
71 0.39
72 0.33
73 0.27
74 0.29
75 0.3
76 0.3
77 0.26
78 0.3
79 0.3
80 0.28
81 0.3
82 0.3
83 0.32
84 0.37
85 0.47
86 0.42
87 0.44
88 0.47
89 0.47
90 0.49
91 0.54
92 0.54
93 0.49
94 0.5
95 0.48
96 0.48
97 0.47
98 0.46
99 0.44
100 0.42
101 0.43
102 0.4
103 0.38
104 0.37
105 0.41
106 0.37
107 0.35
108 0.34
109 0.32
110 0.39
111 0.38
112 0.4
113 0.38
114 0.38
115 0.39
116 0.4
117 0.4
118 0.37
119 0.35
120 0.34
121 0.32
122 0.33
123 0.28
124 0.24
125 0.29
126 0.3
127 0.36
128 0.35
129 0.32
130 0.35
131 0.36
132 0.41
133 0.39
134 0.44
135 0.47
136 0.56
137 0.63
138 0.68
139 0.76
140 0.79
141 0.81
142 0.78
143 0.78
144 0.79
145 0.79
146 0.78
147 0.75
148 0.73
149 0.72
150 0.66
151 0.58
152 0.5
153 0.46
154 0.43
155 0.43
156 0.45