Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L0P7Y1

Protein Details
Accession L0P7Y1    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MKTKPKRKHTSNGRHRFYKTKRCQRGIDQIHBasic
NLS Segment(s)
PositionSequence
5-9PKRKH
Subcellular Location(s) nucl 18, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MKTKPKRKHTSNGRHRFYKTKRCQRGIDQIHEDIATSESRAALLSQEINPDLPGLGQHYCIECSRYFESNNALVKHQSGKFHKKRVKLLKEVPYSQKEAEAAVGIGVKDNIFCTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.81
3 0.81
4 0.79
5 0.79
6 0.79
7 0.79
8 0.82
9 0.81
10 0.82
11 0.8
12 0.81
13 0.77
14 0.75
15 0.69
16 0.59
17 0.53
18 0.47
19 0.39
20 0.29
21 0.22
22 0.14
23 0.09
24 0.08
25 0.07
26 0.07
27 0.07
28 0.06
29 0.05
30 0.06
31 0.08
32 0.08
33 0.09
34 0.09
35 0.09
36 0.09
37 0.09
38 0.07
39 0.06
40 0.05
41 0.06
42 0.06
43 0.07
44 0.07
45 0.08
46 0.09
47 0.1
48 0.12
49 0.1
50 0.14
51 0.16
52 0.18
53 0.18
54 0.18
55 0.21
56 0.24
57 0.28
58 0.25
59 0.23
60 0.22
61 0.23
62 0.27
63 0.26
64 0.29
65 0.32
66 0.42
67 0.48
68 0.58
69 0.63
70 0.65
71 0.72
72 0.76
73 0.77
74 0.76
75 0.77
76 0.77
77 0.78
78 0.77
79 0.75
80 0.68
81 0.64
82 0.54
83 0.48
84 0.38
85 0.31
86 0.26
87 0.19
88 0.15
89 0.11
90 0.12
91 0.09
92 0.1
93 0.1
94 0.09
95 0.08