Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L0PH56

Protein Details
Accession L0PH56   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
38-64LPAGLLKSKHKRSKHKICKITRCKDNAHydrophilic
NLS Segment(s)
PositionSequence
46-51KHKRSK
Subcellular Location(s) cyto_mito 11.499, cyto 11, mito 10.5, cyto_nucl 8.833, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR001240  PRAI_dom  
IPR011060  RibuloseP-bd_barrel  
Gene Ontology GO:0004640  F:phosphoribosylanthranilate isomerase activity  
GO:0000162  P:tryptophan biosynthetic process  
Pfam View protein in Pfam  
PF00697  PRAI  
Amino Acid Sequences MLAGGLTPENVGDALRLNGVIGVDVSGGVETNVLFVHLPAGLLKSKHKRSKHKICKITRCKDNAKSFGFLIDCTGKYTSQGVDFYHFTAMESNLLKRMFTGAYATMTRFLLAFSRSCKQPPTLRGDTYLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.07
5 0.08
6 0.08
7 0.08
8 0.06
9 0.05
10 0.05
11 0.05
12 0.05
13 0.04
14 0.04
15 0.04
16 0.04
17 0.03
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.05
24 0.05
25 0.05
26 0.05
27 0.07
28 0.08
29 0.1
30 0.17
31 0.25
32 0.34
33 0.42
34 0.51
35 0.6
36 0.68
37 0.79
38 0.83
39 0.85
40 0.86
41 0.87
42 0.9
43 0.9
44 0.88
45 0.83
46 0.79
47 0.76
48 0.75
49 0.72
50 0.68
51 0.6
52 0.52
53 0.45
54 0.41
55 0.34
56 0.25
57 0.19
58 0.15
59 0.13
60 0.13
61 0.14
62 0.12
63 0.12
64 0.13
65 0.12
66 0.12
67 0.13
68 0.12
69 0.14
70 0.15
71 0.15
72 0.15
73 0.14
74 0.12
75 0.12
76 0.12
77 0.12
78 0.13
79 0.13
80 0.16
81 0.16
82 0.16
83 0.14
84 0.16
85 0.13
86 0.12
87 0.14
88 0.11
89 0.14
90 0.16
91 0.16
92 0.16
93 0.16
94 0.15
95 0.13
96 0.12
97 0.12
98 0.12
99 0.14
100 0.17
101 0.23
102 0.25
103 0.28
104 0.31
105 0.35
106 0.41
107 0.46
108 0.51
109 0.52
110 0.52