Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L0P9R6

Protein Details
Accession L0P9R6    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
60-87LDKEIIKKKEYKKNNKEKIKTNNFLKSQHydrophilic
NLS Segment(s)
PositionSequence
67-73KKEYKKN
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MTSFRRSGDYRHFSIKTLAPEGTILKGINIYKKGSDPVALKESEYPNWLWKILDEDSSILDKEIIKKKEYKKNNKEKIKTNNFLKSQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.4
4 0.37
5 0.33
6 0.25
7 0.25
8 0.25
9 0.21
10 0.18
11 0.13
12 0.1
13 0.13
14 0.14
15 0.17
16 0.18
17 0.18
18 0.17
19 0.19
20 0.2
21 0.18
22 0.2
23 0.18
24 0.19
25 0.22
26 0.2
27 0.2
28 0.22
29 0.23
30 0.2
31 0.2
32 0.16
33 0.16
34 0.17
35 0.17
36 0.13
37 0.11
38 0.15
39 0.14
40 0.15
41 0.13
42 0.12
43 0.13
44 0.15
45 0.14
46 0.1
47 0.1
48 0.1
49 0.17
50 0.25
51 0.26
52 0.27
53 0.36
54 0.45
55 0.54
56 0.64
57 0.68
58 0.7
59 0.79
60 0.87
61 0.9
62 0.89
63 0.89
64 0.9
65 0.89
66 0.87
67 0.85
68 0.84