Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L0PEL6

Protein Details
Accession L0PEL6   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
19-45IPVKDYTRYRKYCSKKLHRLSKLLGIQHydrophilic
78-104AYAMELKTKNRNHKKPTINHQRVVRRLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR026258  SRP68  
IPR034652  SRP68-RBD  
IPR038253  SRP68_N_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0005047  F:signal recognition particle binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF16969  SRP68  
CDD cd15481  SRP68-RBD  
Amino Acid Sequences MANIGAVFLSIKAQNEHGIPVKDYTRYRKYCSKKLHRLSKLLGIQQINKKYAENEIPSLKSNPKYHDFLIINSERAWAYAMELKTKNRNHKKPTINHQRVVRRLLRAYQYASRLNELMNQELPIFRLQALEYISARRGQLMFECHQWEQSLTNFLEARIILEVIYENNGCQHIKELISSIEQNIRYCAYQQKIPSNDIFGLSQKNILNNQSLASLLTSISPEILKPKNKLHLSIVSQIEWQGRVAPITDVNIAIALSSIQDAYQSMNSEETSTLKEKNEKYDELLQMYSKTENIIKKAIEEFEIEILNNTFFCKIIKLYDDILQNLNVMSDLPGISNDMCFLQRIEQEKYYFRSQRCLIIAESYFLLSDYRSALTLAIHSYDYLSKISIANNKEIIFINETKLINLRKNIDIKINQFRAFLCLTMEEISNEKDTSLKAPTLIEMMDSYSQKLDLSRLIDLPSKLELLFCKPIFFDIAYNYIDYKENIKQLTTSKRGFFKNFLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.24
4 0.28
5 0.29
6 0.28
7 0.31
8 0.32
9 0.36
10 0.41
11 0.45
12 0.5
13 0.52
14 0.58
15 0.64
16 0.7
17 0.73
18 0.78
19 0.8
20 0.81
21 0.86
22 0.9
23 0.88
24 0.87
25 0.83
26 0.81
27 0.77
28 0.71
29 0.67
30 0.6
31 0.59
32 0.59
33 0.61
34 0.54
35 0.48
36 0.45
37 0.39
38 0.43
39 0.42
40 0.38
41 0.37
42 0.4
43 0.41
44 0.42
45 0.45
46 0.44
47 0.44
48 0.45
49 0.46
50 0.46
51 0.49
52 0.47
53 0.52
54 0.47
55 0.41
56 0.45
57 0.41
58 0.36
59 0.32
60 0.32
61 0.23
62 0.22
63 0.21
64 0.12
65 0.12
66 0.17
67 0.18
68 0.23
69 0.27
70 0.31
71 0.39
72 0.46
73 0.54
74 0.59
75 0.68
76 0.7
77 0.77
78 0.82
79 0.83
80 0.87
81 0.87
82 0.85
83 0.81
84 0.81
85 0.8
86 0.76
87 0.75
88 0.69
89 0.64
90 0.58
91 0.59
92 0.55
93 0.5
94 0.49
95 0.46
96 0.46
97 0.46
98 0.44
99 0.39
100 0.34
101 0.31
102 0.32
103 0.28
104 0.26
105 0.21
106 0.2
107 0.18
108 0.18
109 0.19
110 0.14
111 0.13
112 0.1
113 0.11
114 0.1
115 0.12
116 0.14
117 0.15
118 0.15
119 0.16
120 0.17
121 0.18
122 0.18
123 0.17
124 0.16
125 0.14
126 0.17
127 0.2
128 0.21
129 0.23
130 0.27
131 0.25
132 0.25
133 0.25
134 0.22
135 0.18
136 0.18
137 0.2
138 0.16
139 0.19
140 0.18
141 0.17
142 0.18
143 0.17
144 0.16
145 0.11
146 0.11
147 0.07
148 0.07
149 0.08
150 0.06
151 0.08
152 0.07
153 0.06
154 0.08
155 0.09
156 0.09
157 0.09
158 0.11
159 0.11
160 0.12
161 0.12
162 0.12
163 0.12
164 0.14
165 0.14
166 0.14
167 0.17
168 0.17
169 0.17
170 0.17
171 0.17
172 0.15
173 0.17
174 0.21
175 0.18
176 0.21
177 0.25
178 0.31
179 0.33
180 0.35
181 0.34
182 0.3
183 0.29
184 0.26
185 0.23
186 0.17
187 0.17
188 0.14
189 0.18
190 0.16
191 0.17
192 0.18
193 0.19
194 0.19
195 0.17
196 0.17
197 0.13
198 0.12
199 0.11
200 0.09
201 0.08
202 0.06
203 0.06
204 0.06
205 0.05
206 0.06
207 0.05
208 0.05
209 0.1
210 0.15
211 0.19
212 0.22
213 0.27
214 0.35
215 0.36
216 0.38
217 0.36
218 0.38
219 0.38
220 0.41
221 0.38
222 0.3
223 0.29
224 0.28
225 0.25
226 0.19
227 0.15
228 0.1
229 0.09
230 0.08
231 0.09
232 0.08
233 0.07
234 0.08
235 0.09
236 0.07
237 0.07
238 0.07
239 0.06
240 0.05
241 0.04
242 0.03
243 0.03
244 0.03
245 0.03
246 0.03
247 0.03
248 0.03
249 0.05
250 0.06
251 0.07
252 0.07
253 0.08
254 0.08
255 0.09
256 0.09
257 0.09
258 0.11
259 0.12
260 0.14
261 0.15
262 0.21
263 0.21
264 0.29
265 0.32
266 0.3
267 0.32
268 0.37
269 0.37
270 0.33
271 0.32
272 0.25
273 0.22
274 0.22
275 0.18
276 0.11
277 0.11
278 0.13
279 0.15
280 0.16
281 0.19
282 0.18
283 0.19
284 0.21
285 0.21
286 0.17
287 0.16
288 0.15
289 0.13
290 0.13
291 0.12
292 0.1
293 0.1
294 0.09
295 0.08
296 0.07
297 0.06
298 0.06
299 0.06
300 0.07
301 0.07
302 0.09
303 0.11
304 0.13
305 0.15
306 0.19
307 0.21
308 0.21
309 0.21
310 0.19
311 0.17
312 0.15
313 0.13
314 0.08
315 0.07
316 0.06
317 0.05
318 0.05
319 0.05
320 0.05
321 0.07
322 0.07
323 0.07
324 0.07
325 0.07
326 0.07
327 0.07
328 0.08
329 0.1
330 0.14
331 0.19
332 0.22
333 0.25
334 0.28
335 0.31
336 0.35
337 0.4
338 0.42
339 0.39
340 0.42
341 0.4
342 0.44
343 0.42
344 0.4
345 0.32
346 0.31
347 0.31
348 0.24
349 0.23
350 0.17
351 0.15
352 0.12
353 0.12
354 0.07
355 0.07
356 0.07
357 0.08
358 0.08
359 0.08
360 0.08
361 0.08
362 0.1
363 0.1
364 0.09
365 0.09
366 0.09
367 0.1
368 0.11
369 0.12
370 0.11
371 0.1
372 0.1
373 0.12
374 0.16
375 0.21
376 0.22
377 0.25
378 0.27
379 0.27
380 0.28
381 0.28
382 0.26
383 0.25
384 0.24
385 0.22
386 0.25
387 0.24
388 0.23
389 0.28
390 0.29
391 0.29
392 0.32
393 0.34
394 0.35
395 0.39
396 0.41
397 0.44
398 0.46
399 0.48
400 0.54
401 0.55
402 0.5
403 0.47
404 0.45
405 0.4
406 0.36
407 0.29
408 0.2
409 0.15
410 0.15
411 0.15
412 0.16
413 0.13
414 0.14
415 0.15
416 0.16
417 0.15
418 0.14
419 0.14
420 0.14
421 0.16
422 0.18
423 0.17
424 0.16
425 0.17
426 0.18
427 0.18
428 0.17
429 0.15
430 0.11
431 0.13
432 0.16
433 0.16
434 0.17
435 0.16
436 0.16
437 0.16
438 0.16
439 0.16
440 0.16
441 0.18
442 0.2
443 0.2
444 0.23
445 0.28
446 0.27
447 0.27
448 0.24
449 0.23
450 0.2
451 0.21
452 0.2
453 0.22
454 0.3
455 0.28
456 0.28
457 0.26
458 0.28
459 0.29
460 0.27
461 0.23
462 0.18
463 0.22
464 0.21
465 0.22
466 0.21
467 0.2
468 0.21
469 0.2
470 0.22
471 0.24
472 0.28
473 0.29
474 0.29
475 0.31
476 0.37
477 0.46
478 0.49
479 0.49
480 0.5
481 0.56
482 0.62
483 0.64
484 0.61