Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L0PEB7

Protein Details
Accession L0PEB7   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
121-151CYMYKNKSTERTGKKRWIKRIGKGNRLFDRIHydrophilic
NLS Segment(s)
PositionSequence
131-144RTGKKRWIKRIGKG
Subcellular Location(s) mito 12cyto_mito 12, cyto 10, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018108  Mitochondrial_sb/sol_carrier  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00153  Mito_carr  
PROSITE View protein in PROSITE  
PS50920  SOLCAR  
Amino Acid Sequences MCKKKYCEKRGELQGKWKEWLWQVGAAGAAKLIATVATYPHEVIRTRLRQAPKESGKGKYRGLVQCFQVVWKEEGLWGLYGGLTAHLLRVIPNAVIIFGSYELVMSFFAERVEKSKIHKLCYMYKNKSTERTGKKRWIKRIGKGNRLFDRIMPFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.71
3 0.66
4 0.58
5 0.52
6 0.46
7 0.47
8 0.39
9 0.33
10 0.29
11 0.27
12 0.27
13 0.22
14 0.18
15 0.12
16 0.09
17 0.06
18 0.06
19 0.05
20 0.03
21 0.03
22 0.04
23 0.05
24 0.07
25 0.08
26 0.08
27 0.1
28 0.12
29 0.13
30 0.16
31 0.24
32 0.27
33 0.29
34 0.35
35 0.39
36 0.43
37 0.48
38 0.55
39 0.51
40 0.55
41 0.55
42 0.57
43 0.57
44 0.55
45 0.5
46 0.44
47 0.46
48 0.43
49 0.44
50 0.4
51 0.36
52 0.35
53 0.34
54 0.3
55 0.25
56 0.21
57 0.17
58 0.14
59 0.13
60 0.1
61 0.1
62 0.1
63 0.08
64 0.06
65 0.05
66 0.05
67 0.05
68 0.04
69 0.04
70 0.04
71 0.03
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.05
79 0.06
80 0.06
81 0.05
82 0.05
83 0.05
84 0.05
85 0.04
86 0.05
87 0.04
88 0.04
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.07
97 0.07
98 0.1
99 0.14
100 0.15
101 0.2
102 0.29
103 0.32
104 0.35
105 0.4
106 0.41
107 0.48
108 0.55
109 0.61
110 0.59
111 0.62
112 0.66
113 0.66
114 0.69
115 0.66
116 0.66
117 0.67
118 0.69
119 0.71
120 0.74
121 0.8
122 0.82
123 0.85
124 0.86
125 0.84
126 0.84
127 0.86
128 0.86
129 0.86
130 0.86
131 0.85
132 0.82
133 0.78
134 0.7
135 0.63