Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L0PFN3

Protein Details
Accession L0PFN3    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
192-221IDDIKKKDMLKRKSDSRKGENKKRNLKVVYBasic
NLS Segment(s)
PositionSequence
196-216KKKDMLKRKSDSRKGENKKRN
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035503  IOC4-like_PWWP  
IPR000313  PWWP_dom  
Pfam View protein in Pfam  
PF00855  PWWP  
PROSITE View protein in PROSITE  
PS50812  PWWP  
CDD cd05840  PWWP_ScIOC4-like  
Amino Acid Sequences MSTEVVEEPEVLTVKNQESEILNNKIDKKELLKTKGQNKDDLGYSVGDLVLAKISGYPWWPGMIFPEDVVPKDVKDARPVSKKRKNGTEVKYWLVRFFPAPEYIWATKSDIRPLTSEMIDDFLSKKTTKRDIRESYEIAKTNPTVEDLLAQQSFKTNDKALEEDEEEDEDEVEDDEEEVNDDDSNDLKNGDIDDIKKKDMLKRKSDSRKGENKKRNLKVVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.17
4 0.17
5 0.18
6 0.24
7 0.3
8 0.32
9 0.32
10 0.34
11 0.38
12 0.38
13 0.38
14 0.35
15 0.33
16 0.37
17 0.44
18 0.45
19 0.49
20 0.55
21 0.63
22 0.7
23 0.67
24 0.64
25 0.58
26 0.56
27 0.5
28 0.43
29 0.35
30 0.25
31 0.23
32 0.18
33 0.14
34 0.1
35 0.08
36 0.07
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.06
43 0.08
44 0.09
45 0.09
46 0.1
47 0.1
48 0.1
49 0.13
50 0.14
51 0.13
52 0.12
53 0.15
54 0.15
55 0.15
56 0.18
57 0.15
58 0.12
59 0.16
60 0.21
61 0.18
62 0.24
63 0.28
64 0.33
65 0.42
66 0.5
67 0.56
68 0.6
69 0.67
70 0.66
71 0.71
72 0.7
73 0.7
74 0.68
75 0.67
76 0.62
77 0.58
78 0.57
79 0.48
80 0.42
81 0.33
82 0.29
83 0.2
84 0.18
85 0.16
86 0.13
87 0.14
88 0.14
89 0.19
90 0.19
91 0.19
92 0.18
93 0.18
94 0.2
95 0.2
96 0.24
97 0.2
98 0.21
99 0.2
100 0.22
101 0.22
102 0.18
103 0.17
104 0.12
105 0.12
106 0.11
107 0.11
108 0.1
109 0.09
110 0.11
111 0.11
112 0.13
113 0.17
114 0.26
115 0.33
116 0.38
117 0.46
118 0.52
119 0.58
120 0.61
121 0.59
122 0.54
123 0.52
124 0.47
125 0.38
126 0.33
127 0.26
128 0.22
129 0.19
130 0.17
131 0.12
132 0.11
133 0.12
134 0.1
135 0.13
136 0.13
137 0.12
138 0.11
139 0.13
140 0.15
141 0.16
142 0.18
143 0.16
144 0.18
145 0.21
146 0.22
147 0.21
148 0.22
149 0.21
150 0.2
151 0.19
152 0.18
153 0.16
154 0.14
155 0.13
156 0.09
157 0.08
158 0.07
159 0.06
160 0.05
161 0.05
162 0.05
163 0.05
164 0.06
165 0.06
166 0.07
167 0.07
168 0.07
169 0.07
170 0.08
171 0.09
172 0.08
173 0.08
174 0.08
175 0.09
176 0.1
177 0.12
178 0.14
179 0.16
180 0.24
181 0.27
182 0.28
183 0.3
184 0.33
185 0.38
186 0.46
187 0.52
188 0.53
189 0.59
190 0.68
191 0.77
192 0.83
193 0.84
194 0.85
195 0.87
196 0.88
197 0.9
198 0.9
199 0.89
200 0.9
201 0.89