Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L0P7K5

Protein Details
Accession L0P7K5    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
113-134KERIDCQKKKLKILQNKMNTGYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR002777  PFD_beta-like  
IPR009053  Prefoldin  
Gene Ontology GO:0016272  C:prefoldin complex  
GO:0051082  F:unfolded protein binding  
GO:0006457  P:protein folding  
Pfam View protein in Pfam  
PF01920  Prefoldin_2  
Amino Acid Sequences MDLRKKEEISKKKCFSSLMEGKREMSKIRLLKGIDLENQASIEEDIYQDEELVVYEKRKKDNQKGLMEIERQKDQRKVWVNVDNLFVQQKVEETKRCIKEDQEYLESEIKKVKERIDCQKKKLKILQNKMNTGYNDFND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.57
3 0.57
4 0.59
5 0.56
6 0.56
7 0.53
8 0.52
9 0.53
10 0.5
11 0.41
12 0.34
13 0.34
14 0.32
15 0.33
16 0.36
17 0.33
18 0.34
19 0.36
20 0.37
21 0.32
22 0.3
23 0.28
24 0.23
25 0.22
26 0.19
27 0.16
28 0.12
29 0.09
30 0.06
31 0.06
32 0.06
33 0.07
34 0.07
35 0.06
36 0.06
37 0.05
38 0.05
39 0.06
40 0.07
41 0.08
42 0.13
43 0.16
44 0.21
45 0.28
46 0.36
47 0.44
48 0.53
49 0.6
50 0.6
51 0.6
52 0.59
53 0.57
54 0.53
55 0.47
56 0.4
57 0.35
58 0.32
59 0.32
60 0.33
61 0.3
62 0.34
63 0.37
64 0.38
65 0.4
66 0.45
67 0.44
68 0.41
69 0.43
70 0.35
71 0.29
72 0.26
73 0.2
74 0.13
75 0.11
76 0.1
77 0.12
78 0.16
79 0.18
80 0.23
81 0.32
82 0.37
83 0.4
84 0.4
85 0.39
86 0.42
87 0.46
88 0.46
89 0.4
90 0.36
91 0.37
92 0.41
93 0.38
94 0.32
95 0.31
96 0.26
97 0.29
98 0.31
99 0.34
100 0.37
101 0.44
102 0.54
103 0.61
104 0.67
105 0.7
106 0.76
107 0.76
108 0.76
109 0.78
110 0.77
111 0.77
112 0.79
113 0.81
114 0.81
115 0.82
116 0.77
117 0.74
118 0.66
119 0.61