Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L0P8A9

Protein Details
Accession L0P8A9    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
44-76VQCLSKERLKQQRAKPKKKKEKRQNAEISKEDQHydrophilic
NLS Segment(s)
PositionSequence
51-66RLKQQRAKPKKKKEKR
Subcellular Location(s) nucl 18.5, cyto_nucl 13.833, cyto 6, cyto_pero 3.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MHPPISAHKHPDCYEIMQELEKCHKSGFFNYFLGKCNNLKKDVVQCLSKERLKQQRAKPKKKKEKRQNAEISKEDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.33
3 0.29
4 0.26
5 0.26
6 0.24
7 0.29
8 0.27
9 0.24
10 0.23
11 0.24
12 0.23
13 0.28
14 0.3
15 0.26
16 0.26
17 0.29
18 0.29
19 0.29
20 0.28
21 0.25
22 0.24
23 0.27
24 0.27
25 0.27
26 0.26
27 0.27
28 0.32
29 0.36
30 0.36
31 0.31
32 0.3
33 0.33
34 0.39
35 0.39
36 0.35
37 0.38
38 0.45
39 0.5
40 0.58
41 0.62
42 0.67
43 0.76
44 0.84
45 0.86
46 0.88
47 0.92
48 0.94
49 0.96
50 0.96
51 0.96
52 0.94
53 0.94
54 0.94
55 0.92
56 0.9