Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L0PDV8

Protein Details
Accession L0PDV8    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
135-154ACVCNPRKRPHYPKNWQENLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002495  Glyco_trans_8  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016757  F:glycosyltransferase activity  
Pfam View protein in Pfam  
PF01501  Glyco_transf_8  
Amino Acid Sequences MEEYSAKRCWVTLLSDLGEKDGYLNGVLTDLYKCNVVVCSVINLRTWQKCTSNALSILQKSGIKIKYVDTLYPGKVQDYGADTRRFNECFNKLRAFSLFEYERVVFIDSDMIFMKNADELFDIHLDKGCIASAHACVCNPRKRPHYPKNWQENLLRIPLNCAYTAQQEMPLDSPVVPCTFGIRMLNSGLIVLNPNPDEFILILDHVKNSDKYPATMLSFAEQSLLSYIYEEKWQPLPYIYNALKTLRTVHDKLWNDKDVKIVHYILDKPWSEENDGLNSNDPTHAWWWSVEKERKAEMNSIAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.3
4 0.29
5 0.26
6 0.21
7 0.17
8 0.13
9 0.12
10 0.09
11 0.1
12 0.08
13 0.08
14 0.08
15 0.09
16 0.1
17 0.1
18 0.1
19 0.11
20 0.11
21 0.12
22 0.12
23 0.12
24 0.11
25 0.11
26 0.16
27 0.18
28 0.19
29 0.19
30 0.22
31 0.28
32 0.32
33 0.34
34 0.34
35 0.35
36 0.38
37 0.44
38 0.45
39 0.44
40 0.41
41 0.41
42 0.42
43 0.39
44 0.37
45 0.32
46 0.28
47 0.24
48 0.29
49 0.27
50 0.23
51 0.24
52 0.24
53 0.28
54 0.29
55 0.28
56 0.25
57 0.28
58 0.28
59 0.31
60 0.29
61 0.23
62 0.22
63 0.22
64 0.2
65 0.2
66 0.22
67 0.24
68 0.28
69 0.27
70 0.28
71 0.33
72 0.31
73 0.29
74 0.33
75 0.34
76 0.36
77 0.41
78 0.43
79 0.39
80 0.4
81 0.4
82 0.36
83 0.3
84 0.31
85 0.26
86 0.22
87 0.25
88 0.23
89 0.21
90 0.18
91 0.18
92 0.11
93 0.1
94 0.14
95 0.1
96 0.11
97 0.12
98 0.11
99 0.1
100 0.1
101 0.1
102 0.07
103 0.07
104 0.07
105 0.07
106 0.07
107 0.09
108 0.1
109 0.11
110 0.09
111 0.1
112 0.1
113 0.09
114 0.09
115 0.07
116 0.06
117 0.05
118 0.06
119 0.07
120 0.09
121 0.09
122 0.09
123 0.13
124 0.2
125 0.27
126 0.31
127 0.36
128 0.41
129 0.5
130 0.61
131 0.67
132 0.71
133 0.74
134 0.79
135 0.83
136 0.8
137 0.75
138 0.66
139 0.61
140 0.52
141 0.46
142 0.37
143 0.26
144 0.24
145 0.22
146 0.21
147 0.16
148 0.15
149 0.12
150 0.13
151 0.15
152 0.12
153 0.13
154 0.12
155 0.13
156 0.13
157 0.12
158 0.11
159 0.1
160 0.1
161 0.08
162 0.08
163 0.08
164 0.07
165 0.08
166 0.08
167 0.1
168 0.1
169 0.1
170 0.11
171 0.11
172 0.11
173 0.09
174 0.09
175 0.07
176 0.07
177 0.07
178 0.06
179 0.08
180 0.08
181 0.08
182 0.08
183 0.08
184 0.08
185 0.07
186 0.08
187 0.06
188 0.07
189 0.08
190 0.08
191 0.08
192 0.09
193 0.11
194 0.11
195 0.11
196 0.18
197 0.18
198 0.18
199 0.21
200 0.23
201 0.22
202 0.23
203 0.22
204 0.17
205 0.16
206 0.15
207 0.14
208 0.11
209 0.09
210 0.09
211 0.09
212 0.07
213 0.08
214 0.09
215 0.08
216 0.12
217 0.12
218 0.14
219 0.17
220 0.18
221 0.18
222 0.2
223 0.22
224 0.21
225 0.29
226 0.27
227 0.27
228 0.29
229 0.29
230 0.28
231 0.26
232 0.29
233 0.27
234 0.33
235 0.31
236 0.33
237 0.41
238 0.45
239 0.51
240 0.55
241 0.55
242 0.5
243 0.49
244 0.51
245 0.44
246 0.4
247 0.37
248 0.3
249 0.26
250 0.29
251 0.3
252 0.26
253 0.31
254 0.3
255 0.29
256 0.33
257 0.34
258 0.32
259 0.33
260 0.33
261 0.32
262 0.33
263 0.31
264 0.29
265 0.27
266 0.25
267 0.23
268 0.2
269 0.18
270 0.18
271 0.18
272 0.16
273 0.17
274 0.2
275 0.26
276 0.36
277 0.41
278 0.45
279 0.48
280 0.52
281 0.56
282 0.55
283 0.54