Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L0PEF7

Protein Details
Accession L0PEF7    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-32AAAQSKTGKTKKKWSKGKVKDKSNNLVIHydrophilic
NLS Segment(s)
PositionSequence
10-24KTGKTKKKWSKGKVK
Subcellular Location(s) nucl 11, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MVKAAAAQSKTGKTKKKWSKGKVKDKSNNLVIIDDALCDRIYKDVMYYRMISISVLVDRFKINGTLARKILNLLCEQGIIKKVCIHHAQAIYTRVTAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.69
3 0.75
4 0.79
5 0.81
6 0.85
7 0.87
8 0.92
9 0.91
10 0.91
11 0.89
12 0.87
13 0.84
14 0.78
15 0.71
16 0.6
17 0.51
18 0.4
19 0.32
20 0.24
21 0.16
22 0.12
23 0.08
24 0.07
25 0.07
26 0.07
27 0.06
28 0.07
29 0.07
30 0.08
31 0.11
32 0.13
33 0.15
34 0.15
35 0.15
36 0.14
37 0.14
38 0.13
39 0.09
40 0.08
41 0.07
42 0.07
43 0.07
44 0.07
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.13
51 0.17
52 0.2
53 0.21
54 0.22
55 0.22
56 0.23
57 0.24
58 0.21
59 0.18
60 0.16
61 0.15
62 0.14
63 0.14
64 0.15
65 0.19
66 0.18
67 0.18
68 0.2
69 0.21
70 0.27
71 0.3
72 0.32
73 0.33
74 0.35
75 0.38
76 0.39
77 0.41
78 0.36