Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L0P7W3

Protein Details
Accession L0P7W3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
133-159QKNELANYKKQNRQKKEQRKREWLLEDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011012  Longin-like_dom_sf  
Amino Acid Sequences MASAIYFLDLKGKILISRDYRGDIPVTYVEKFLSLISESDDTVPATPCFTYEGIHYLYIRHSNLYILTLTRKNSNAAELLLFLHKMIRIKYQKTLLKMQEHYGNNLFILMLRQLLQHMMDVAFVQRDSKKDLQKNELANYKKQNRQKKEQRKREWLLED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.26
3 0.26
4 0.3
5 0.31
6 0.32
7 0.32
8 0.32
9 0.31
10 0.24
11 0.22
12 0.22
13 0.23
14 0.2
15 0.2
16 0.18
17 0.17
18 0.17
19 0.14
20 0.11
21 0.09
22 0.09
23 0.11
24 0.12
25 0.12
26 0.12
27 0.13
28 0.11
29 0.11
30 0.13
31 0.1
32 0.11
33 0.1
34 0.09
35 0.11
36 0.11
37 0.1
38 0.09
39 0.12
40 0.13
41 0.14
42 0.14
43 0.12
44 0.14
45 0.17
46 0.16
47 0.14
48 0.12
49 0.12
50 0.12
51 0.13
52 0.11
53 0.08
54 0.12
55 0.14
56 0.15
57 0.17
58 0.17
59 0.18
60 0.18
61 0.18
62 0.15
63 0.13
64 0.12
65 0.1
66 0.1
67 0.08
68 0.08
69 0.06
70 0.06
71 0.07
72 0.08
73 0.09
74 0.17
75 0.21
76 0.24
77 0.28
78 0.36
79 0.38
80 0.41
81 0.47
82 0.44
83 0.46
84 0.46
85 0.44
86 0.44
87 0.41
88 0.41
89 0.35
90 0.3
91 0.23
92 0.21
93 0.19
94 0.1
95 0.11
96 0.07
97 0.06
98 0.06
99 0.07
100 0.07
101 0.08
102 0.08
103 0.07
104 0.08
105 0.07
106 0.07
107 0.07
108 0.08
109 0.08
110 0.07
111 0.1
112 0.11
113 0.13
114 0.2
115 0.27
116 0.35
117 0.41
118 0.48
119 0.53
120 0.57
121 0.61
122 0.61
123 0.62
124 0.57
125 0.58
126 0.61
127 0.63
128 0.65
129 0.68
130 0.72
131 0.73
132 0.8
133 0.84
134 0.86
135 0.88
136 0.91
137 0.93
138 0.93
139 0.92