Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L0PEU8

Protein Details
Accession L0PEU8    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-42IGPLQKPFKNPQFKRNPRRNKTLRQILTHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MVSSSQSLLDTVDIGPLQKPFKNPQFKRNPRRNKTLRQILTHETQLRHSQPLLLDVPTYNSIEASPSLFPHAKWCDITGLHGLYTDPKTGLRFHNKEVFAVIKNMTQGVEQQYLQMRGSQVMLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.14
4 0.17
5 0.19
6 0.23
7 0.29
8 0.39
9 0.49
10 0.52
11 0.59
12 0.67
13 0.75
14 0.82
15 0.84
16 0.86
17 0.82
18 0.9
19 0.88
20 0.87
21 0.86
22 0.86
23 0.81
24 0.75
25 0.72
26 0.66
27 0.6
28 0.55
29 0.49
30 0.39
31 0.36
32 0.36
33 0.33
34 0.3
35 0.27
36 0.23
37 0.19
38 0.22
39 0.2
40 0.15
41 0.13
42 0.12
43 0.14
44 0.13
45 0.13
46 0.09
47 0.08
48 0.08
49 0.08
50 0.08
51 0.08
52 0.07
53 0.06
54 0.1
55 0.1
56 0.1
57 0.16
58 0.18
59 0.19
60 0.19
61 0.2
62 0.19
63 0.19
64 0.21
65 0.17
66 0.15
67 0.13
68 0.13
69 0.12
70 0.13
71 0.14
72 0.13
73 0.11
74 0.12
75 0.13
76 0.16
77 0.24
78 0.31
79 0.33
80 0.37
81 0.45
82 0.44
83 0.43
84 0.43
85 0.38
86 0.3
87 0.29
88 0.25
89 0.19
90 0.19
91 0.19
92 0.17
93 0.14
94 0.15
95 0.18
96 0.2
97 0.19
98 0.22
99 0.26
100 0.28
101 0.28
102 0.28
103 0.24
104 0.21