Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L0PCV0

Protein Details
Accession L0PCV0   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
42-62WAAPKKKTSYSKKRMRQATKGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MTKTLTQSIRVPWAPILVDTMQNRDPLCIENGGEVLSTAILWAAPKKKTSYSKKRMRQATKGLKDLYNLNECPACGRKKLAHTLCLFCFREIKEFIKSRQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.24
4 0.17
5 0.22
6 0.21
7 0.24
8 0.23
9 0.25
10 0.25
11 0.22
12 0.21
13 0.18
14 0.19
15 0.16
16 0.14
17 0.12
18 0.12
19 0.12
20 0.1
21 0.08
22 0.06
23 0.05
24 0.04
25 0.03
26 0.03
27 0.03
28 0.03
29 0.06
30 0.1
31 0.12
32 0.14
33 0.16
34 0.22
35 0.32
36 0.42
37 0.5
38 0.57
39 0.66
40 0.73
41 0.79
42 0.83
43 0.8
44 0.78
45 0.78
46 0.78
47 0.74
48 0.71
49 0.65
50 0.56
51 0.5
52 0.46
53 0.4
54 0.34
55 0.29
56 0.25
57 0.23
58 0.22
59 0.25
60 0.27
61 0.24
62 0.21
63 0.25
64 0.29
65 0.34
66 0.45
67 0.46
68 0.48
69 0.5
70 0.53
71 0.53
72 0.56
73 0.52
74 0.42
75 0.42
76 0.36
77 0.38
78 0.37
79 0.37
80 0.37
81 0.41