Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K9GLF1

Protein Details
Accession K9GLF1    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-35KAIRSKNTISKRKLMRQRQCRRKASLMKKACHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MAAIKAIRSKNTISKRKLMRQRQCRRKASLMKKACEYSRMCSADVCVGIRVRETGQVYILLADTSGFWAFLSSQLVCLQLWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.66
3 0.73
4 0.79
5 0.8
6 0.8
7 0.82
8 0.88
9 0.9
10 0.91
11 0.88
12 0.85
13 0.84
14 0.84
15 0.83
16 0.82
17 0.79
18 0.72
19 0.68
20 0.65
21 0.55
22 0.51
23 0.43
24 0.36
25 0.36
26 0.35
27 0.3
28 0.27
29 0.27
30 0.23
31 0.22
32 0.18
33 0.11
34 0.1
35 0.1
36 0.1
37 0.11
38 0.09
39 0.13
40 0.14
41 0.13
42 0.13
43 0.14
44 0.13
45 0.13
46 0.12
47 0.08
48 0.06
49 0.06
50 0.05
51 0.06
52 0.06
53 0.06
54 0.06
55 0.07
56 0.07
57 0.09
58 0.12
59 0.1
60 0.12
61 0.13
62 0.14