Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9G0Y3

Protein Details
Accession K9G0Y3   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-22SRMKSFRATRHRRIRGSQNDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito_nucl 13.666, cyto_nucl 12.166
Family & Domain DBs
Amino Acid Sequences MSSRMKSFRATRHRRIRGSQNDWGFPARRCRSTNCDSHRLNPYTHKGVHIASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.8
4 0.79
5 0.77
6 0.74
7 0.67
8 0.59
9 0.55
10 0.5
11 0.42
12 0.33
13 0.36
14 0.32
15 0.33
16 0.33
17 0.37
18 0.42
19 0.46
20 0.53
21 0.5
22 0.56
23 0.53
24 0.57
25 0.61
26 0.56
27 0.53
28 0.52
29 0.52
30 0.5
31 0.49
32 0.46
33 0.39