Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9FW02

Protein Details
Accession K9FW02   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-32SQFSSKVPSNTQKKHKCKVCDKRFTRPSSLHydrophilic
59-78VSNLRRHKKVHKGEKDAGSGBasic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MMSQFSSKVPSNTQKKHKCKVCDKRFTRPSSLQTHMYSHTGEKPFACDVEGCGRHFSVVSNLRRHKKVHKGEKDAGSGDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.75
3 0.82
4 0.83
5 0.83
6 0.84
7 0.86
8 0.86
9 0.87
10 0.84
11 0.85
12 0.85
13 0.81
14 0.77
15 0.72
16 0.67
17 0.63
18 0.61
19 0.55
20 0.48
21 0.45
22 0.38
23 0.33
24 0.28
25 0.22
26 0.24
27 0.21
28 0.19
29 0.17
30 0.18
31 0.17
32 0.16
33 0.15
34 0.09
35 0.1
36 0.18
37 0.2
38 0.19
39 0.2
40 0.2
41 0.19
42 0.19
43 0.18
44 0.18
45 0.24
46 0.29
47 0.36
48 0.45
49 0.51
50 0.55
51 0.59
52 0.6
53 0.62
54 0.68
55 0.7
56 0.73
57 0.75
58 0.8
59 0.82
60 0.78
61 0.69
62 0.59