Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9FEF8

Protein Details
Accession K9FEF8    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
109-129VSKGWSKKTVRQKAKEQNAELHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MAPRLPTSKLHLINNLIQSQSLTSFQMAEAAECSEQTIKNICRNLRLFGHVHAPSTRIGRRRSITPPMLEALCDHLLEKPGRYLEEMAIFLRDEFRMLASTSSIRRALVSKGWSKKTVRQKAKEQNAELREIYLHKLSEFESYHLVYVDESGCDKRIGFRRTGWSPLGVAPRQVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.48
3 0.39
4 0.33
5 0.3
6 0.26
7 0.23
8 0.18
9 0.14
10 0.12
11 0.12
12 0.12
13 0.15
14 0.14
15 0.12
16 0.12
17 0.12
18 0.12
19 0.11
20 0.13
21 0.11
22 0.11
23 0.13
24 0.19
25 0.21
26 0.27
27 0.32
28 0.32
29 0.38
30 0.4
31 0.42
32 0.38
33 0.39
34 0.34
35 0.31
36 0.37
37 0.3
38 0.3
39 0.26
40 0.25
41 0.22
42 0.26
43 0.28
44 0.26
45 0.28
46 0.33
47 0.35
48 0.39
49 0.43
50 0.46
51 0.47
52 0.42
53 0.41
54 0.36
55 0.33
56 0.28
57 0.23
58 0.19
59 0.15
60 0.13
61 0.12
62 0.11
63 0.14
64 0.14
65 0.14
66 0.12
67 0.12
68 0.12
69 0.13
70 0.13
71 0.11
72 0.12
73 0.12
74 0.1
75 0.1
76 0.1
77 0.09
78 0.09
79 0.08
80 0.06
81 0.05
82 0.06
83 0.06
84 0.07
85 0.07
86 0.07
87 0.09
88 0.1
89 0.13
90 0.13
91 0.12
92 0.12
93 0.14
94 0.15
95 0.17
96 0.21
97 0.26
98 0.32
99 0.36
100 0.4
101 0.42
102 0.48
103 0.54
104 0.6
105 0.62
106 0.63
107 0.7
108 0.76
109 0.83
110 0.83
111 0.76
112 0.74
113 0.66
114 0.63
115 0.52
116 0.43
117 0.33
118 0.27
119 0.25
120 0.19
121 0.18
122 0.14
123 0.15
124 0.15
125 0.2
126 0.2
127 0.19
128 0.19
129 0.19
130 0.2
131 0.19
132 0.18
133 0.12
134 0.13
135 0.12
136 0.09
137 0.11
138 0.12
139 0.13
140 0.13
141 0.14
142 0.2
143 0.28
144 0.31
145 0.33
146 0.38
147 0.45
148 0.49
149 0.54
150 0.49
151 0.42
152 0.39
153 0.42
154 0.44
155 0.36