Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RE04

Protein Details
Accession E3RE04    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
24-48APGSPKSDKKAFKHERKQSEKTHYDBasic
NLS Segment(s)
PositionSequence
28-37PKSDKKAFKH
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018809  DUF2406  
KEGG pte:PTT_03530  -  
Pfam View protein in Pfam  
PF10295  DUF2406  
Amino Acid Sequences MDQATQHQPRQRGLSFHSNKSREAPGSPKSDKKAFKHERKQSEKTHYDVTTKANPNAAMVELQPIAAALEKPTLQSLRSFQHTDSAGNPIVDPDLSNPTRSRWERPLDTIRSFEAAIDGEYRRRAQSMRVDQSEVMSTYGSRRSSYYGGVGGGNGGGYNDQSRFSSNGGYFPHKQTQRDSYVDGYAHGGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.55
3 0.6
4 0.65
5 0.6
6 0.58
7 0.58
8 0.57
9 0.48
10 0.46
11 0.43
12 0.4
13 0.47
14 0.5
15 0.52
16 0.52
17 0.58
18 0.61
19 0.6
20 0.65
21 0.67
22 0.72
23 0.77
24 0.8
25 0.83
26 0.84
27 0.87
28 0.84
29 0.84
30 0.77
31 0.7
32 0.67
33 0.59
34 0.52
35 0.47
36 0.43
37 0.42
38 0.42
39 0.4
40 0.35
41 0.33
42 0.3
43 0.29
44 0.24
45 0.15
46 0.11
47 0.12
48 0.09
49 0.09
50 0.08
51 0.07
52 0.07
53 0.06
54 0.06
55 0.05
56 0.06
57 0.07
58 0.07
59 0.09
60 0.09
61 0.09
62 0.11
63 0.14
64 0.15
65 0.19
66 0.2
67 0.19
68 0.23
69 0.24
70 0.23
71 0.2
72 0.21
73 0.18
74 0.16
75 0.16
76 0.11
77 0.1
78 0.09
79 0.08
80 0.06
81 0.11
82 0.12
83 0.13
84 0.14
85 0.15
86 0.23
87 0.25
88 0.29
89 0.29
90 0.35
91 0.36
92 0.42
93 0.48
94 0.45
95 0.45
96 0.42
97 0.36
98 0.31
99 0.29
100 0.22
101 0.15
102 0.1
103 0.09
104 0.1
105 0.1
106 0.1
107 0.12
108 0.13
109 0.13
110 0.14
111 0.14
112 0.18
113 0.27
114 0.35
115 0.41
116 0.42
117 0.44
118 0.43
119 0.43
120 0.4
121 0.3
122 0.21
123 0.13
124 0.11
125 0.12
126 0.17
127 0.16
128 0.15
129 0.16
130 0.19
131 0.2
132 0.22
133 0.22
134 0.18
135 0.18
136 0.17
137 0.16
138 0.12
139 0.11
140 0.09
141 0.06
142 0.05
143 0.04
144 0.05
145 0.07
146 0.07
147 0.09
148 0.1
149 0.12
150 0.14
151 0.15
152 0.21
153 0.19
154 0.24
155 0.27
156 0.33
157 0.35
158 0.39
159 0.47
160 0.46
161 0.48
162 0.5
163 0.54
164 0.54
165 0.54
166 0.52
167 0.46
168 0.45
169 0.43
170 0.37