Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9F951

Protein Details
Accession K9F951    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTCKKESRKERRDKSKWSGGWRDBasic
NLS Segment(s)
PositionSequence
8-12RKERR
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MTCKKESRKERRDKSKWSGGWRDDDGSGRVTLTPFGRWTHDMGRGSALGWCLGVVKRHDRTGRKTPLPACLAAAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.83
4 0.81
5 0.79
6 0.71
7 0.68
8 0.6
9 0.53
10 0.44
11 0.4
12 0.32
13 0.25
14 0.21
15 0.16
16 0.14
17 0.12
18 0.12
19 0.11
20 0.11
21 0.11
22 0.12
23 0.14
24 0.14
25 0.17
26 0.18
27 0.23
28 0.23
29 0.22
30 0.22
31 0.2
32 0.19
33 0.18
34 0.15
35 0.09
36 0.08
37 0.07
38 0.07
39 0.08
40 0.12
41 0.14
42 0.21
43 0.25
44 0.32
45 0.39
46 0.44
47 0.51
48 0.58
49 0.65
50 0.63
51 0.68
52 0.64
53 0.66
54 0.63
55 0.56