Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K9G7K5

Protein Details
Accession K9G7K5    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
71-95FKWMHDRDRRKEKEKREKERAQFGKBasic
142-167NDMARKRQKNYIKRVKKDQRAEDLSRHydrophilic
NLS Segment(s)
PositionSequence
77-97RDRRKEKEKREKERAQFGKVK
Subcellular Location(s) cyto 8, cyto_nucl 8, nucl 6, pero 5, cysk 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MSTPQADLSEKAAAAALDFFGQIYAFFELIVTRFFKNGYASIAQMSGKRWTKVIGSVIFYLLIRPYIEKTFKWMHDRDRRKEKEKREKERAQFGKVKVSPNSLRAGGDGGKGKVLGEVDNTDDELEDEEDLMAAASGVPEWNDMARKRQKNYIKRVKKDQRAEDLSRDQIMELLDWSEEEEVDVKVKKDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.1
4 0.07
5 0.07
6 0.07
7 0.06
8 0.06
9 0.06
10 0.07
11 0.08
12 0.08
13 0.07
14 0.08
15 0.08
16 0.09
17 0.11
18 0.11
19 0.1
20 0.11
21 0.11
22 0.13
23 0.15
24 0.16
25 0.18
26 0.17
27 0.17
28 0.18
29 0.19
30 0.18
31 0.17
32 0.18
33 0.22
34 0.25
35 0.25
36 0.24
37 0.24
38 0.25
39 0.28
40 0.32
41 0.26
42 0.25
43 0.25
44 0.25
45 0.24
46 0.22
47 0.18
48 0.12
49 0.1
50 0.07
51 0.08
52 0.1
53 0.14
54 0.17
55 0.16
56 0.21
57 0.26
58 0.3
59 0.35
60 0.37
61 0.42
62 0.5
63 0.59
64 0.62
65 0.68
66 0.71
67 0.73
68 0.77
69 0.79
70 0.8
71 0.81
72 0.82
73 0.81
74 0.83
75 0.8
76 0.83
77 0.76
78 0.71
79 0.66
80 0.58
81 0.57
82 0.5
83 0.49
84 0.39
85 0.41
86 0.36
87 0.32
88 0.33
89 0.24
90 0.22
91 0.18
92 0.19
93 0.14
94 0.14
95 0.14
96 0.12
97 0.12
98 0.12
99 0.11
100 0.11
101 0.1
102 0.08
103 0.07
104 0.08
105 0.09
106 0.09
107 0.1
108 0.08
109 0.08
110 0.08
111 0.08
112 0.07
113 0.06
114 0.06
115 0.05
116 0.05
117 0.05
118 0.05
119 0.03
120 0.03
121 0.03
122 0.02
123 0.03
124 0.03
125 0.03
126 0.04
127 0.04
128 0.06
129 0.11
130 0.12
131 0.22
132 0.31
133 0.38
134 0.41
135 0.5
136 0.59
137 0.64
138 0.74
139 0.76
140 0.77
141 0.79
142 0.87
143 0.88
144 0.88
145 0.88
146 0.86
147 0.85
148 0.82
149 0.79
150 0.76
151 0.71
152 0.64
153 0.55
154 0.47
155 0.36
156 0.3
157 0.26
158 0.19
159 0.13
160 0.11
161 0.09
162 0.09
163 0.1
164 0.09
165 0.08
166 0.08
167 0.09
168 0.08
169 0.12
170 0.15