Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9G4G8

Protein Details
Accession K9G4G8    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
14-40WKTPWRLSSPQKARQRKRLRSVDRVVDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKSTQALFGGLLWKTPWRLSSPQKARQRKRLRSVDRVVDTVSAALERNGQTSKAVSRWFAEMPREEEMLPKDKYTLFDKKEKSYRKSIHSMFSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.18
4 0.19
5 0.2
6 0.27
7 0.34
8 0.44
9 0.51
10 0.59
11 0.68
12 0.77
13 0.79
14 0.83
15 0.86
16 0.85
17 0.86
18 0.87
19 0.85
20 0.84
21 0.82
22 0.8
23 0.71
24 0.62
25 0.52
26 0.42
27 0.34
28 0.24
29 0.17
30 0.09
31 0.07
32 0.06
33 0.07
34 0.07
35 0.09
36 0.09
37 0.09
38 0.09
39 0.1
40 0.12
41 0.12
42 0.14
43 0.13
44 0.14
45 0.16
46 0.17
47 0.19
48 0.21
49 0.21
50 0.23
51 0.24
52 0.24
53 0.22
54 0.23
55 0.24
56 0.27
57 0.25
58 0.22
59 0.21
60 0.22
61 0.25
62 0.28
63 0.34
64 0.33
65 0.41
66 0.46
67 0.53
68 0.61
69 0.67
70 0.66
71 0.68
72 0.7
73 0.69
74 0.75
75 0.7