Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9FGK8

Protein Details
Accession K9FGK8   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
160-185ANNAGQKKASRSKKEKIKDAMNKVIPHydrophilic
NLS Segment(s)
PositionSequence
166-178KKASRSKKEKIKD
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MATEGASGQSSAASDQDTAQLVKEHSHAFQNRLNTTETDSPPIPETENSDIYIDPLKAEVGLEAPKPTPETKPPVTEPTGSALGSIPVARKSQIPVGPKDETVAGEKRDIDSTVTPTPALTEDEEQQKPGPSDEPDSKKPKTGEKPVTDSNGNTVAPSSANNAGQKKASRSKKEKIKDAMNKVIPGDGIGSRTRSRTKGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.12
4 0.13
5 0.13
6 0.14
7 0.16
8 0.15
9 0.17
10 0.19
11 0.18
12 0.18
13 0.26
14 0.28
15 0.3
16 0.33
17 0.38
18 0.37
19 0.37
20 0.37
21 0.3
22 0.33
23 0.36
24 0.34
25 0.32
26 0.31
27 0.3
28 0.29
29 0.29
30 0.25
31 0.18
32 0.22
33 0.22
34 0.23
35 0.23
36 0.22
37 0.21
38 0.2
39 0.22
40 0.17
41 0.12
42 0.1
43 0.09
44 0.08
45 0.08
46 0.07
47 0.06
48 0.08
49 0.09
50 0.1
51 0.1
52 0.11
53 0.13
54 0.14
55 0.16
56 0.19
57 0.26
58 0.28
59 0.32
60 0.34
61 0.37
62 0.38
63 0.36
64 0.32
65 0.28
66 0.27
67 0.22
68 0.19
69 0.14
70 0.12
71 0.11
72 0.11
73 0.08
74 0.08
75 0.08
76 0.09
77 0.09
78 0.11
79 0.16
80 0.19
81 0.22
82 0.23
83 0.27
84 0.28
85 0.27
86 0.26
87 0.21
88 0.18
89 0.18
90 0.18
91 0.14
92 0.14
93 0.14
94 0.14
95 0.15
96 0.14
97 0.13
98 0.11
99 0.15
100 0.15
101 0.15
102 0.14
103 0.13
104 0.13
105 0.12
106 0.12
107 0.1
108 0.1
109 0.13
110 0.19
111 0.2
112 0.2
113 0.2
114 0.2
115 0.2
116 0.19
117 0.19
118 0.14
119 0.19
120 0.27
121 0.32
122 0.37
123 0.43
124 0.43
125 0.46
126 0.47
127 0.51
128 0.52
129 0.56
130 0.58
131 0.58
132 0.63
133 0.62
134 0.64
135 0.56
136 0.48
137 0.41
138 0.35
139 0.29
140 0.23
141 0.19
142 0.15
143 0.13
144 0.14
145 0.14
146 0.13
147 0.17
148 0.22
149 0.23
150 0.25
151 0.29
152 0.32
153 0.36
154 0.42
155 0.49
156 0.55
157 0.61
158 0.69
159 0.75
160 0.8
161 0.82
162 0.81
163 0.82
164 0.81
165 0.82
166 0.82
167 0.77
168 0.7
169 0.61
170 0.54
171 0.43
172 0.33
173 0.27
174 0.18
175 0.17
176 0.17
177 0.21
178 0.21
179 0.27
180 0.32