Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9G9V1

Protein Details
Accession K9G9V1    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
41-72GGKKMRSNIMKRERKKKENKGKATEMNRKGNNBasic
NLS Segment(s)
PositionSequence
43-71KKMRSNIMKRERKKKENKGKATEMNRKGN
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MIWISLQWDLLKGLIQKKEGYLNVPPRAPVEEEFRPCAEMGGKKMRSNIMKRERKKKENKGKATEMNRKGNNHKSSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.25
4 0.27
5 0.32
6 0.3
7 0.29
8 0.31
9 0.36
10 0.38
11 0.37
12 0.36
13 0.31
14 0.32
15 0.31
16 0.25
17 0.23
18 0.24
19 0.26
20 0.28
21 0.27
22 0.26
23 0.24
24 0.22
25 0.18
26 0.14
27 0.16
28 0.23
29 0.25
30 0.25
31 0.27
32 0.32
33 0.36
34 0.4
35 0.46
36 0.47
37 0.55
38 0.62
39 0.71
40 0.76
41 0.8
42 0.86
43 0.87
44 0.88
45 0.89
46 0.91
47 0.89
48 0.88
49 0.87
50 0.86
51 0.85
52 0.82
53 0.81
54 0.77
55 0.74
56 0.74
57 0.75