Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9GCZ1

Protein Details
Accession K9GCZ1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
182-201AEIYAKRERERAKKQGGKKQBasic
NLS Segment(s)
PositionSequence
187-201KRERERAKKQGGKKQ
Subcellular Location(s) plas 21, E.R. 3, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024960  PEMT/MFAP  
IPR007318  Phopholipid_MeTrfase  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0031966  C:mitochondrial membrane  
GO:0080101  F:phosphatidyl-N-dimethylethanolamine N-methyltransferase activity  
GO:0000773  F:phosphatidyl-N-methylethanolamine N-methyltransferase activity  
GO:0032259  P:methylation  
GO:0006656  P:phosphatidylcholine biosynthetic process  
Pfam View protein in Pfam  
PF04191  PEMT  
PROSITE View protein in PROSITE  
PS51599  SAM_PEMT_PEM2  
Amino Acid Sequences MASITDFVDFSSKPLLWSAATIAFNPIFWNIVARAEYRNHFLTRLFGGAYNGCYFLAITIFSLGIFRDHVYQLALADQPFYAPVHQPIIGGALFTIGSVLVLSSMWALGVTGTYLGDYFGILMDAPVTGFPFNVTGSPMYWGSTLNFLGVALYHGKVAGLLLTAQVFVLYWFALGWEDPFTAEIYAKRERERAKKQGGKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.16
4 0.17
5 0.18
6 0.19
7 0.19
8 0.19
9 0.21
10 0.19
11 0.19
12 0.19
13 0.17
14 0.12
15 0.11
16 0.13
17 0.1
18 0.13
19 0.14
20 0.15
21 0.18
22 0.21
23 0.23
24 0.25
25 0.28
26 0.26
27 0.26
28 0.25
29 0.25
30 0.23
31 0.22
32 0.18
33 0.15
34 0.16
35 0.16
36 0.17
37 0.15
38 0.14
39 0.12
40 0.12
41 0.1
42 0.09
43 0.08
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.05
51 0.06
52 0.06
53 0.06
54 0.08
55 0.08
56 0.09
57 0.09
58 0.09
59 0.09
60 0.1
61 0.1
62 0.08
63 0.08
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.08
71 0.1
72 0.1
73 0.1
74 0.09
75 0.11
76 0.1
77 0.09
78 0.07
79 0.05
80 0.05
81 0.05
82 0.05
83 0.02
84 0.02
85 0.02
86 0.02
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.04
115 0.04
116 0.04
117 0.04
118 0.05
119 0.06
120 0.06
121 0.07
122 0.07
123 0.08
124 0.1
125 0.1
126 0.1
127 0.1
128 0.1
129 0.1
130 0.12
131 0.12
132 0.1
133 0.09
134 0.08
135 0.08
136 0.07
137 0.08
138 0.07
139 0.07
140 0.07
141 0.07
142 0.07
143 0.07
144 0.07
145 0.06
146 0.04
147 0.04
148 0.05
149 0.05
150 0.06
151 0.05
152 0.05
153 0.05
154 0.04
155 0.05
156 0.04
157 0.04
158 0.04
159 0.05
160 0.05
161 0.06
162 0.06
163 0.08
164 0.08
165 0.08
166 0.09
167 0.1
168 0.1
169 0.12
170 0.13
171 0.17
172 0.24
173 0.27
174 0.3
175 0.37
176 0.44
177 0.53
178 0.61
179 0.66
180 0.7
181 0.76