Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9G3F8

Protein Details
Accession K9G3F8   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-38NKDLRAANEKQKQKRTRSRRQIPTEEGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 3
Family & Domain DBs
Amino Acid Sequences MQGAILLAKENKDLRAANEKQKQKRTRSRRQIPTEEGLSVQEASQLITEPVEAIEVPPLPPRRSPSPALQPRTRAPPKCSGCGEIGHKINRCLAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.33
3 0.37
4 0.43
5 0.5
6 0.58
7 0.63
8 0.72
9 0.76
10 0.76
11 0.82
12 0.82
13 0.85
14 0.87
15 0.89
16 0.89
17 0.9
18 0.87
19 0.82
20 0.76
21 0.67
22 0.56
23 0.46
24 0.35
25 0.27
26 0.19
27 0.13
28 0.1
29 0.08
30 0.07
31 0.07
32 0.07
33 0.06
34 0.05
35 0.05
36 0.04
37 0.04
38 0.04
39 0.04
40 0.03
41 0.05
42 0.05
43 0.06
44 0.11
45 0.15
46 0.16
47 0.18
48 0.24
49 0.29
50 0.33
51 0.37
52 0.39
53 0.47
54 0.55
55 0.6
56 0.59
57 0.58
58 0.57
59 0.64
60 0.65
61 0.6
62 0.57
63 0.6
64 0.6
65 0.62
66 0.61
67 0.54
68 0.48
69 0.48
70 0.47
71 0.45
72 0.46
73 0.47
74 0.47
75 0.45