Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9FVI9

Protein Details
Accession K9FVI9   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
59-80VEAVERKKKEKKRAAHPTHVLHBasic
NLS Segment(s)
PositionSequence
64-72RKKKEKKRA
Subcellular Location(s) mito 13, nucl 9, cyto_nucl 7.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MESHPPLFPFRGHYKAPAGLQPLGTHSTATKDGTDSSAKPSPYLPEGRQKGFGTSVEAVEAVERKKKEKKRAAHPTHVLHWRDLLSSHGLSLSHTHLPFSAPGEAKTHPW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.42
4 0.39
5 0.36
6 0.32
7 0.32
8 0.28
9 0.26
10 0.24
11 0.22
12 0.18
13 0.14
14 0.16
15 0.17
16 0.17
17 0.15
18 0.13
19 0.14
20 0.16
21 0.18
22 0.16
23 0.2
24 0.23
25 0.22
26 0.22
27 0.22
28 0.21
29 0.23
30 0.27
31 0.23
32 0.29
33 0.32
34 0.33
35 0.37
36 0.35
37 0.33
38 0.3
39 0.27
40 0.21
41 0.18
42 0.17
43 0.12
44 0.12
45 0.1
46 0.09
47 0.1
48 0.07
49 0.11
50 0.12
51 0.16
52 0.25
53 0.33
54 0.44
55 0.51
56 0.59
57 0.66
58 0.77
59 0.81
60 0.82
61 0.82
62 0.75
63 0.73
64 0.73
65 0.63
66 0.52
67 0.46
68 0.37
69 0.3
70 0.26
71 0.21
72 0.17
73 0.16
74 0.15
75 0.14
76 0.13
77 0.13
78 0.16
79 0.17
80 0.19
81 0.19
82 0.19
83 0.19
84 0.2
85 0.21
86 0.22
87 0.25
88 0.2
89 0.22
90 0.25