Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9G6Z4

Protein Details
Accession K9G6Z4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
90-116HPPGTSDPASKKRQKKRQSQVDISSHQHydrophilic
NLS Segment(s)
PositionSequence
101-104KRQK
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR043519  NT_sf  
IPR045862  Trf4-like  
Gene Ontology GO:0016020  C:membrane  
GO:0031499  C:TRAMP complex  
GO:0043631  P:RNA polyadenylation  
Amino Acid Sequences MQLLSLPFRIRPSHLFRPFHSSVTAAKTSDVFANSLRKTLEAHRSTNRSRLIRKIYPLEDSAGLWRPEISYERRADYQPPAEPTLPSSEHPPGTSDPASKKRQKKRQSQVDISSHQSLINRHGKDAIQPAGTGRPAQSPWLTNLELPRANAEITLDAEIRALDQYLLPTAQERDRVEKLRAEIASLLKAVVSHAPRVIGSHCTGLVLAHSDLDFILPYKDLPRSLERGRRPSPTRPQVQGAHTRLLRQVQRALQHTDIFGDSVKLSEKRNPSLSACHQPTGLLLQFYCGDGIPAITEYLQDYQAEYPALRPLYVVTRTLLEARDLFGSPQASIGPDALAMLIVAFLKINHGRFPGPNNLGDQFLALLQFFGTQVDLQSVVVSVDPPKLFSADMLPVASEADEPAYQRGQRSLISAKRTAAAKRNFLVAQRLCIQDPTHYMNDLGRSCTRTSELQAAFAAAYQKLCHACDEWAGVGNIKSSSVLATTLQANFDGLEKVRNQLAYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.6
3 0.58
4 0.65
5 0.62
6 0.56
7 0.49
8 0.4
9 0.35
10 0.38
11 0.38
12 0.29
13 0.28
14 0.27
15 0.27
16 0.29
17 0.25
18 0.19
19 0.2
20 0.28
21 0.27
22 0.3
23 0.29
24 0.25
25 0.27
26 0.34
27 0.41
28 0.37
29 0.43
30 0.48
31 0.56
32 0.59
33 0.64
34 0.65
35 0.62
36 0.62
37 0.65
38 0.66
39 0.65
40 0.68
41 0.69
42 0.64
43 0.6
44 0.57
45 0.5
46 0.42
47 0.36
48 0.33
49 0.31
50 0.28
51 0.23
52 0.22
53 0.19
54 0.21
55 0.25
56 0.26
57 0.28
58 0.31
59 0.35
60 0.37
61 0.39
62 0.4
63 0.43
64 0.44
65 0.41
66 0.42
67 0.43
68 0.41
69 0.39
70 0.37
71 0.36
72 0.32
73 0.27
74 0.28
75 0.29
76 0.29
77 0.29
78 0.3
79 0.25
80 0.29
81 0.31
82 0.31
83 0.34
84 0.41
85 0.5
86 0.56
87 0.64
88 0.69
89 0.76
90 0.81
91 0.84
92 0.87
93 0.89
94 0.91
95 0.9
96 0.88
97 0.86
98 0.79
99 0.73
100 0.65
101 0.54
102 0.45
103 0.39
104 0.31
105 0.31
106 0.36
107 0.32
108 0.29
109 0.32
110 0.31
111 0.33
112 0.37
113 0.32
114 0.25
115 0.24
116 0.25
117 0.25
118 0.25
119 0.22
120 0.17
121 0.17
122 0.17
123 0.2
124 0.21
125 0.19
126 0.21
127 0.26
128 0.25
129 0.23
130 0.25
131 0.27
132 0.26
133 0.25
134 0.23
135 0.19
136 0.18
137 0.17
138 0.15
139 0.11
140 0.1
141 0.12
142 0.1
143 0.09
144 0.09
145 0.09
146 0.08
147 0.08
148 0.07
149 0.05
150 0.05
151 0.06
152 0.07
153 0.07
154 0.06
155 0.08
156 0.1
157 0.12
158 0.17
159 0.18
160 0.22
161 0.28
162 0.31
163 0.32
164 0.33
165 0.33
166 0.33
167 0.31
168 0.27
169 0.25
170 0.22
171 0.21
172 0.18
173 0.16
174 0.1
175 0.1
176 0.1
177 0.12
178 0.12
179 0.11
180 0.12
181 0.12
182 0.12
183 0.14
184 0.14
185 0.12
186 0.12
187 0.12
188 0.12
189 0.11
190 0.11
191 0.1
192 0.09
193 0.08
194 0.07
195 0.06
196 0.06
197 0.06
198 0.06
199 0.06
200 0.06
201 0.04
202 0.05
203 0.04
204 0.05
205 0.07
206 0.09
207 0.09
208 0.12
209 0.15
210 0.2
211 0.26
212 0.34
213 0.37
214 0.44
215 0.47
216 0.52
217 0.54
218 0.57
219 0.62
220 0.62
221 0.62
222 0.57
223 0.59
224 0.55
225 0.55
226 0.55
227 0.48
228 0.44
229 0.39
230 0.37
231 0.34
232 0.34
233 0.32
234 0.25
235 0.27
236 0.25
237 0.29
238 0.31
239 0.32
240 0.29
241 0.27
242 0.25
243 0.21
244 0.18
245 0.14
246 0.11
247 0.08
248 0.06
249 0.06
250 0.08
251 0.09
252 0.1
253 0.16
254 0.2
255 0.22
256 0.26
257 0.27
258 0.27
259 0.32
260 0.35
261 0.38
262 0.37
263 0.34
264 0.31
265 0.28
266 0.27
267 0.24
268 0.2
269 0.12
270 0.09
271 0.1
272 0.1
273 0.1
274 0.1
275 0.07
276 0.06
277 0.05
278 0.05
279 0.04
280 0.04
281 0.04
282 0.04
283 0.04
284 0.05
285 0.07
286 0.07
287 0.07
288 0.08
289 0.08
290 0.09
291 0.09
292 0.08
293 0.08
294 0.11
295 0.11
296 0.1
297 0.1
298 0.1
299 0.14
300 0.16
301 0.16
302 0.13
303 0.14
304 0.15
305 0.17
306 0.16
307 0.12
308 0.11
309 0.11
310 0.13
311 0.12
312 0.11
313 0.12
314 0.12
315 0.11
316 0.11
317 0.1
318 0.09
319 0.09
320 0.09
321 0.07
322 0.06
323 0.06
324 0.05
325 0.05
326 0.04
327 0.03
328 0.03
329 0.03
330 0.03
331 0.03
332 0.03
333 0.07
334 0.1
335 0.11
336 0.13
337 0.15
338 0.17
339 0.19
340 0.24
341 0.29
342 0.29
343 0.29
344 0.3
345 0.29
346 0.29
347 0.27
348 0.22
349 0.14
350 0.11
351 0.1
352 0.07
353 0.06
354 0.05
355 0.05
356 0.05
357 0.05
358 0.06
359 0.05
360 0.06
361 0.07
362 0.07
363 0.06
364 0.07
365 0.06
366 0.06
367 0.06
368 0.07
369 0.07
370 0.11
371 0.11
372 0.13
373 0.13
374 0.14
375 0.14
376 0.13
377 0.16
378 0.13
379 0.15
380 0.13
381 0.13
382 0.12
383 0.12
384 0.12
385 0.08
386 0.06
387 0.07
388 0.07
389 0.08
390 0.11
391 0.14
392 0.15
393 0.16
394 0.19
395 0.19
396 0.19
397 0.23
398 0.29
399 0.32
400 0.36
401 0.38
402 0.37
403 0.39
404 0.42
405 0.42
406 0.44
407 0.45
408 0.45
409 0.44
410 0.48
411 0.45
412 0.44
413 0.48
414 0.4
415 0.38
416 0.37
417 0.38
418 0.33
419 0.34
420 0.33
421 0.27
422 0.31
423 0.32
424 0.29
425 0.27
426 0.28
427 0.27
428 0.33
429 0.31
430 0.3
431 0.27
432 0.29
433 0.29
434 0.31
435 0.31
436 0.28
437 0.3
438 0.35
439 0.32
440 0.31
441 0.31
442 0.29
443 0.25
444 0.24
445 0.23
446 0.14
447 0.14
448 0.12
449 0.16
450 0.18
451 0.19
452 0.19
453 0.19
454 0.19
455 0.21
456 0.24
457 0.21
458 0.21
459 0.21
460 0.21
461 0.2
462 0.2
463 0.18
464 0.15
465 0.14
466 0.11
467 0.12
468 0.11
469 0.11
470 0.1
471 0.12
472 0.15
473 0.16
474 0.17
475 0.16
476 0.16
477 0.15
478 0.15
479 0.16
480 0.13
481 0.17
482 0.17
483 0.2
484 0.24