Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9FBR6

Protein Details
Accession K9FBR6   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-32RSASPSNTPRTQRAKRRLARASPPTAPHydrophilic
NLS Segment(s)
PositionSequence
19-22AKRR
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003615  HNH_nuc  
Pfam View protein in Pfam  
PF13391  HNH_2  
Amino Acid Sequences MAKRNRSASPSNTPRTQRAKRRLARASPPTAPPPTAPPLTASPPTVPRGLSTLSTDTADSLTSLEKDARVRIEAYENQSLRDETLLKSGLNAFLTWLPEAGRTSLARDVLKTSSGRELYDVFMNLFTGLAAPMKSRSKAPSVVESPHSKRQEQVDTVAATLDQPERRDSSFAAQLQLRDNYRCVITGQLNTDQWEHEGEPGNVSHGPTEGAHIIPFAFASWPGVSGAPRDTSSTWTLLYKCFPALRRVLAVEEINTLRNGITLRDSVHTQFGKFTIALKPTDIENEYEVKTYKRYPPADIPAIPSDRHVRLLPNTEHEIPCPAILDAHWRMCEIFNASAMGDTIERHRRDWEELKGSGRAVVREDGTTDLASLLDIALWGQVSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.75
3 0.77
4 0.77
5 0.78
6 0.81
7 0.81
8 0.87
9 0.88
10 0.86
11 0.86
12 0.85
13 0.82
14 0.77
15 0.74
16 0.71
17 0.64
18 0.57
19 0.48
20 0.45
21 0.44
22 0.4
23 0.34
24 0.31
25 0.32
26 0.35
27 0.36
28 0.33
29 0.31
30 0.33
31 0.36
32 0.34
33 0.3
34 0.25
35 0.26
36 0.26
37 0.23
38 0.22
39 0.23
40 0.22
41 0.23
42 0.22
43 0.19
44 0.17
45 0.15
46 0.11
47 0.09
48 0.09
49 0.09
50 0.1
51 0.11
52 0.13
53 0.15
54 0.18
55 0.2
56 0.2
57 0.2
58 0.21
59 0.26
60 0.29
61 0.33
62 0.38
63 0.36
64 0.36
65 0.36
66 0.35
67 0.28
68 0.26
69 0.22
70 0.14
71 0.18
72 0.19
73 0.17
74 0.17
75 0.18
76 0.18
77 0.17
78 0.16
79 0.13
80 0.13
81 0.15
82 0.14
83 0.13
84 0.11
85 0.12
86 0.13
87 0.12
88 0.13
89 0.12
90 0.15
91 0.17
92 0.2
93 0.19
94 0.19
95 0.21
96 0.19
97 0.22
98 0.2
99 0.19
100 0.22
101 0.23
102 0.22
103 0.21
104 0.21
105 0.19
106 0.21
107 0.19
108 0.13
109 0.12
110 0.12
111 0.1
112 0.09
113 0.07
114 0.05
115 0.05
116 0.05
117 0.05
118 0.06
119 0.1
120 0.13
121 0.14
122 0.16
123 0.19
124 0.22
125 0.27
126 0.29
127 0.32
128 0.33
129 0.35
130 0.37
131 0.41
132 0.42
133 0.45
134 0.46
135 0.39
136 0.39
137 0.41
138 0.44
139 0.38
140 0.36
141 0.31
142 0.29
143 0.28
144 0.25
145 0.19
146 0.12
147 0.12
148 0.13
149 0.1
150 0.11
151 0.13
152 0.15
153 0.16
154 0.17
155 0.16
156 0.17
157 0.21
158 0.21
159 0.21
160 0.2
161 0.21
162 0.23
163 0.25
164 0.23
165 0.18
166 0.18
167 0.16
168 0.16
169 0.15
170 0.13
171 0.13
172 0.14
173 0.15
174 0.17
175 0.18
176 0.19
177 0.19
178 0.19
179 0.16
180 0.14
181 0.13
182 0.11
183 0.11
184 0.13
185 0.12
186 0.13
187 0.12
188 0.13
189 0.12
190 0.12
191 0.1
192 0.07
193 0.08
194 0.07
195 0.08
196 0.08
197 0.07
198 0.07
199 0.07
200 0.07
201 0.06
202 0.06
203 0.04
204 0.04
205 0.04
206 0.06
207 0.05
208 0.06
209 0.07
210 0.07
211 0.07
212 0.08
213 0.1
214 0.1
215 0.1
216 0.12
217 0.12
218 0.15
219 0.16
220 0.16
221 0.15
222 0.16
223 0.17
224 0.17
225 0.17
226 0.15
227 0.15
228 0.18
229 0.19
230 0.21
231 0.23
232 0.23
233 0.24
234 0.24
235 0.23
236 0.22
237 0.2
238 0.16
239 0.16
240 0.15
241 0.14
242 0.13
243 0.13
244 0.1
245 0.11
246 0.1
247 0.08
248 0.1
249 0.1
250 0.12
251 0.14
252 0.16
253 0.16
254 0.22
255 0.22
256 0.2
257 0.2
258 0.19
259 0.19
260 0.18
261 0.19
262 0.18
263 0.19
264 0.2
265 0.19
266 0.19
267 0.18
268 0.22
269 0.2
270 0.16
271 0.16
272 0.18
273 0.18
274 0.19
275 0.2
276 0.17
277 0.19
278 0.23
279 0.29
280 0.35
281 0.36
282 0.4
283 0.48
284 0.54
285 0.57
286 0.53
287 0.51
288 0.48
289 0.47
290 0.42
291 0.36
292 0.34
293 0.3
294 0.31
295 0.28
296 0.26
297 0.29
298 0.37
299 0.37
300 0.37
301 0.41
302 0.43
303 0.42
304 0.39
305 0.37
306 0.3
307 0.27
308 0.23
309 0.17
310 0.13
311 0.12
312 0.19
313 0.2
314 0.23
315 0.24
316 0.23
317 0.24
318 0.24
319 0.27
320 0.23
321 0.19
322 0.17
323 0.17
324 0.17
325 0.16
326 0.15
327 0.14
328 0.1
329 0.1
330 0.16
331 0.23
332 0.25
333 0.26
334 0.31
335 0.34
336 0.41
337 0.48
338 0.5
339 0.49
340 0.5
341 0.53
342 0.5
343 0.47
344 0.43
345 0.39
346 0.31
347 0.27
348 0.28
349 0.25
350 0.24
351 0.25
352 0.23
353 0.22
354 0.21
355 0.18
356 0.14
357 0.12
358 0.11
359 0.1
360 0.07
361 0.05
362 0.05
363 0.05
364 0.05