Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9FLX8

Protein Details
Accession K9FLX8   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
190-215VTYKRTQLEAPPKGKRRKCREAKEVDHydrophilic
NLS Segment(s)
PositionSequence
202-207KGKRRK
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 7
Family & Domain DBs
Amino Acid Sequences MPSVKPILPPLKTPKTEIFPSQLHNGSSVSDYIKREDQSTPITPPTAYTEFLKALTPVFTGPMSAGLGFPKYDKASTTTSPTSQPASAFSGSTFSDLVRSPTISLPPPTPNSAAPSRKSFHGRRLRIQSSLKFSPSSDSPRSATPWSAATPKSATTLRSPFLPSDWTLRYYDSPRSAKPVSVKQVVTRTVTYKRTQLEAPPKGKRRKCREAKEVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.55
3 0.58
4 0.55
5 0.51
6 0.44
7 0.46
8 0.47
9 0.44
10 0.37
11 0.34
12 0.31
13 0.26
14 0.24
15 0.21
16 0.18
17 0.19
18 0.2
19 0.23
20 0.27
21 0.27
22 0.28
23 0.28
24 0.29
25 0.31
26 0.33
27 0.33
28 0.3
29 0.3
30 0.27
31 0.26
32 0.29
33 0.25
34 0.23
35 0.21
36 0.22
37 0.22
38 0.23
39 0.22
40 0.16
41 0.14
42 0.13
43 0.12
44 0.09
45 0.1
46 0.09
47 0.08
48 0.08
49 0.09
50 0.08
51 0.08
52 0.08
53 0.07
54 0.08
55 0.08
56 0.08
57 0.1
58 0.11
59 0.11
60 0.12
61 0.15
62 0.18
63 0.2
64 0.25
65 0.24
66 0.25
67 0.26
68 0.27
69 0.25
70 0.22
71 0.2
72 0.17
73 0.18
74 0.17
75 0.15
76 0.14
77 0.13
78 0.13
79 0.13
80 0.11
81 0.07
82 0.09
83 0.09
84 0.11
85 0.1
86 0.1
87 0.1
88 0.11
89 0.13
90 0.13
91 0.14
92 0.14
93 0.16
94 0.18
95 0.19
96 0.19
97 0.18
98 0.2
99 0.26
100 0.27
101 0.27
102 0.29
103 0.29
104 0.31
105 0.38
106 0.36
107 0.4
108 0.46
109 0.48
110 0.52
111 0.59
112 0.58
113 0.57
114 0.6
115 0.55
116 0.52
117 0.5
118 0.44
119 0.36
120 0.33
121 0.31
122 0.29
123 0.31
124 0.26
125 0.26
126 0.26
127 0.27
128 0.3
129 0.29
130 0.26
131 0.21
132 0.2
133 0.19
134 0.22
135 0.2
136 0.19
137 0.19
138 0.19
139 0.21
140 0.2
141 0.2
142 0.22
143 0.26
144 0.24
145 0.26
146 0.27
147 0.24
148 0.24
149 0.25
150 0.2
151 0.22
152 0.24
153 0.24
154 0.23
155 0.24
156 0.27
157 0.28
158 0.33
159 0.36
160 0.38
161 0.36
162 0.42
163 0.41
164 0.41
165 0.45
166 0.47
167 0.46
168 0.48
169 0.48
170 0.47
171 0.53
172 0.52
173 0.49
174 0.43
175 0.41
176 0.42
177 0.46
178 0.43
179 0.42
180 0.42
181 0.41
182 0.41
183 0.46
184 0.49
185 0.53
186 0.59
187 0.63
188 0.7
189 0.77
190 0.82
191 0.84
192 0.83
193 0.85
194 0.87
195 0.88