Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9F5Q8

Protein Details
Accession K9F5Q8   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
4-23HFSCPRLKKTQRRSDFIVNKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, mito_nucl 12.333, cyto_mito 11.333, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MSGHFSCPRLKKTQRRSDFIVNKPAAAPPLFLRMVSRPALCFKKRSTLVPPNIQLTFVLSVSMGFTVGDIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.78
3 0.8
4 0.81
5 0.8
6 0.75
7 0.74
8 0.63
9 0.55
10 0.49
11 0.43
12 0.34
13 0.25
14 0.2
15 0.11
16 0.16
17 0.16
18 0.15
19 0.15
20 0.15
21 0.18
22 0.18
23 0.17
24 0.13
25 0.19
26 0.25
27 0.26
28 0.28
29 0.27
30 0.34
31 0.36
32 0.39
33 0.43
34 0.46
35 0.52
36 0.57
37 0.58
38 0.53
39 0.51
40 0.47
41 0.38
42 0.31
43 0.25
44 0.17
45 0.14
46 0.1
47 0.1
48 0.1
49 0.1
50 0.07
51 0.05