Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K9GDU6

Protein Details
Accession K9GDU6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
36-64SNRTKTGCMTCRRRKKKCDEQHPACKFTPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
CDD cd00067  GAL4  
Amino Acid Sequences MTNRSTPGTQQPSSPSYAPDRHGAAQVAPKRKRVFSNRTKTGCMTCRRRKKKCDEQHPACKFTPYGSSFPVSFSLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.32
3 0.31
4 0.34
5 0.33
6 0.32
7 0.32
8 0.29
9 0.31
10 0.29
11 0.24
12 0.27
13 0.31
14 0.37
15 0.36
16 0.41
17 0.41
18 0.44
19 0.49
20 0.51
21 0.55
22 0.56
23 0.64
24 0.67
25 0.67
26 0.66
27 0.6
28 0.57
29 0.54
30 0.52
31 0.52
32 0.53
33 0.61
34 0.7
35 0.77
36 0.81
37 0.85
38 0.87
39 0.88
40 0.89
41 0.89
42 0.89
43 0.91
44 0.88
45 0.82
46 0.72
47 0.64
48 0.53
49 0.44
50 0.42
51 0.36
52 0.33
53 0.3
54 0.32
55 0.3
56 0.31