Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9FQM1

Protein Details
Accession K9FQM1   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
2-22DYKVQHWRYHIQNRNKKPLLFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9, mito 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MDYKVQHWRYHIQNRNKKPLLFMDPSDVSKKTHLSRLSTTVRDVYLSTKIGDATAPLQPNQIFMLNARDASDSSDRRMACAGVESLLGLALWSSSLYRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.85
3 0.83
4 0.74
5 0.67
6 0.65
7 0.62
8 0.56
9 0.48
10 0.44
11 0.4
12 0.42
13 0.41
14 0.34
15 0.27
16 0.25
17 0.29
18 0.24
19 0.29
20 0.3
21 0.31
22 0.33
23 0.39
24 0.42
25 0.38
26 0.37
27 0.32
28 0.29
29 0.25
30 0.22
31 0.16
32 0.14
33 0.14
34 0.13
35 0.12
36 0.11
37 0.11
38 0.1
39 0.08
40 0.07
41 0.1
42 0.1
43 0.1
44 0.12
45 0.12
46 0.13
47 0.14
48 0.13
49 0.1
50 0.1
51 0.15
52 0.13
53 0.14
54 0.14
55 0.13
56 0.13
57 0.17
58 0.23
59 0.19
60 0.22
61 0.26
62 0.25
63 0.26
64 0.27
65 0.23
66 0.16
67 0.18
68 0.15
69 0.11
70 0.11
71 0.1
72 0.09
73 0.09
74 0.08
75 0.05
76 0.04
77 0.03
78 0.04
79 0.04