Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9FPM3

Protein Details
Accession K9FPM3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MSTRSHHGCWTCKRRRRRCDNARPSCQNCTDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MSTRSHHGCWTCKRRRRRCDNARPSCQNCTDRGAACEGYEVRLRWGMGIASRGRLTGADTPAKNSVPPRPRGRQRDLIKERERHAELEQGSALHGSRDLELAVSQRRVVDDEVLFNECELAAETV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.89
3 0.91
4 0.91
5 0.92
6 0.92
7 0.95
8 0.95
9 0.94
10 0.92
11 0.86
12 0.82
13 0.78
14 0.69
15 0.61
16 0.55
17 0.49
18 0.4
19 0.37
20 0.34
21 0.26
22 0.23
23 0.23
24 0.18
25 0.17
26 0.18
27 0.17
28 0.15
29 0.17
30 0.17
31 0.14
32 0.14
33 0.12
34 0.1
35 0.14
36 0.13
37 0.13
38 0.13
39 0.13
40 0.12
41 0.12
42 0.13
43 0.13
44 0.16
45 0.18
46 0.18
47 0.2
48 0.22
49 0.22
50 0.21
51 0.19
52 0.23
53 0.25
54 0.32
55 0.37
56 0.44
57 0.53
58 0.61
59 0.66
60 0.68
61 0.67
62 0.71
63 0.71
64 0.72
65 0.7
66 0.68
67 0.64
68 0.62
69 0.57
70 0.48
71 0.43
72 0.4
73 0.32
74 0.29
75 0.27
76 0.19
77 0.17
78 0.16
79 0.14
80 0.08
81 0.08
82 0.07
83 0.07
84 0.08
85 0.07
86 0.07
87 0.08
88 0.12
89 0.15
90 0.16
91 0.16
92 0.16
93 0.17
94 0.19
95 0.2
96 0.21
97 0.18
98 0.21
99 0.23
100 0.24
101 0.23
102 0.2
103 0.19
104 0.14
105 0.13