Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9G1L2

Protein Details
Accession K9G1L2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
16-39LINRRDRQSVRRSRKNPSERLRKLHydrophilic
NLS Segment(s)
PositionSequence
27-31RSRKN
Subcellular Location(s) mito 7, extr 7, plas 4, mito_nucl 4, cyto 2, pero 2, E.R. 2, golg 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MLFHVILTVSSSLTILINRRDRQSVRRSRKNPSERLRKLDKVSPICTLENWWTTTKGNLGLSEAVDGEFIWYVYSALLVEWRLTFCSALFVWSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.19
4 0.27
5 0.3
6 0.33
7 0.39
8 0.41
9 0.48
10 0.55
11 0.58
12 0.61
13 0.69
14 0.7
15 0.74
16 0.81
17 0.82
18 0.81
19 0.81
20 0.81
21 0.76
22 0.79
23 0.77
24 0.71
25 0.66
26 0.61
27 0.59
28 0.53
29 0.49
30 0.46
31 0.41
32 0.35
33 0.32
34 0.28
35 0.23
36 0.2
37 0.2
38 0.17
39 0.16
40 0.16
41 0.17
42 0.16
43 0.16
44 0.15
45 0.13
46 0.14
47 0.13
48 0.13
49 0.12
50 0.11
51 0.08
52 0.07
53 0.07
54 0.06
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.04
63 0.04
64 0.06
65 0.07
66 0.08
67 0.08
68 0.1
69 0.11
70 0.12
71 0.12
72 0.1
73 0.14
74 0.13