Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9GSC1

Protein Details
Accession K9GSC1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
131-150REFMKTEKRLRIKHQKEATLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019180  Oxidoreductase-like_N  
IPR039251  OXLD1  
Pfam View protein in Pfam  
PF09791  Oxidored-like  
Amino Acid Sequences MAIVFGTRLAGPGRSSRYNPGEAPPLSRWKTINGVPIPPQPEEPDNCCMSGCVHCVWDDFRDEMEDWASRIATAKAKGGPEKGTKDMRSAPRAEVRSASGSMDDDGGGSEASWTPPNEDNELFANVPVGIREFMKTEKRLRIKHQKEATL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.38
4 0.42
5 0.45
6 0.44
7 0.42
8 0.44
9 0.4
10 0.43
11 0.39
12 0.43
13 0.42
14 0.43
15 0.4
16 0.35
17 0.4
18 0.38
19 0.42
20 0.35
21 0.36
22 0.37
23 0.41
24 0.4
25 0.36
26 0.34
27 0.28
28 0.29
29 0.29
30 0.29
31 0.29
32 0.27
33 0.26
34 0.24
35 0.22
36 0.19
37 0.18
38 0.16
39 0.12
40 0.12
41 0.12
42 0.13
43 0.14
44 0.13
45 0.13
46 0.12
47 0.11
48 0.13
49 0.13
50 0.12
51 0.12
52 0.11
53 0.09
54 0.09
55 0.09
56 0.07
57 0.07
58 0.08
59 0.1
60 0.1
61 0.12
62 0.14
63 0.16
64 0.17
65 0.18
66 0.21
67 0.23
68 0.25
69 0.28
70 0.31
71 0.3
72 0.31
73 0.37
74 0.38
75 0.37
76 0.36
77 0.35
78 0.37
79 0.38
80 0.36
81 0.3
82 0.27
83 0.26
84 0.25
85 0.21
86 0.15
87 0.14
88 0.13
89 0.12
90 0.09
91 0.07
92 0.06
93 0.06
94 0.05
95 0.05
96 0.05
97 0.05
98 0.07
99 0.09
100 0.09
101 0.13
102 0.18
103 0.21
104 0.24
105 0.23
106 0.24
107 0.24
108 0.27
109 0.23
110 0.18
111 0.17
112 0.13
113 0.13
114 0.11
115 0.1
116 0.08
117 0.09
118 0.1
119 0.12
120 0.17
121 0.25
122 0.3
123 0.36
124 0.45
125 0.53
126 0.59
127 0.67
128 0.74
129 0.74
130 0.79