Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K9GK00

Protein Details
Accession K9GK00    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-22KSKNASQHHRSQKAHRNGIKHydrophilic
NLS Segment(s)
PositionSequence
12-63RSQKAHRNGIKKPKTNRYPSLNGVDPKFRRNHRHALHGTMKALKERKEGKRE
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNASQHHRSQKAHRNGIKKPKTNRYPSLNGVDPKFRRNHRHALHGTMKALKERKEGKREVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.82
4 0.77
5 0.74
6 0.73
7 0.8
8 0.79
9 0.77
10 0.75
11 0.76
12 0.78
13 0.79
14 0.77
15 0.74
16 0.7
17 0.65
18 0.62
19 0.56
20 0.49
21 0.43
22 0.43
23 0.37
24 0.36
25 0.38
26 0.39
27 0.43
28 0.46
29 0.55
30 0.51
31 0.6
32 0.58
33 0.61
34 0.62
35 0.57
36 0.54
37 0.48
38 0.46
39 0.43
40 0.45
41 0.4
42 0.42
43 0.48
44 0.55
45 0.6